Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R1GAD8

Protein Details
Accession R1GAD8    Localization Confidence Low Confidence Score 6.7
NoLS Segment(s)
PositionSequenceProtein Nature
3-49AAKKHVPIVKKHTKRFNRHQSDRFKCVDPSWRKPKGIDNRVRRRFSGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, cyto_nucl 6, nucl 5.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG npa:UCRNP2_8116  -  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVAAKKHVPIVKKHTKRFNRHQSDRFKCVDPSWRKPKGIDNRVRRRFSGQAAMPKIGYGSNKKTRHMMPSGHRAFLVNNARDVDILLMHNRTYAAEIAHAVSARKRIEIVARAKQLGVKVTNGKAKITTES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.79
3 0.84
4 0.87
5 0.89
6 0.88
7 0.89
8 0.89
9 0.89
10 0.87
11 0.83
12 0.76
13 0.68
14 0.59
15 0.53
16 0.55
17 0.52
18 0.54
19 0.58
20 0.61
21 0.59
22 0.59
23 0.65
24 0.65
25 0.67
26 0.67
27 0.68
28 0.72
29 0.8
30 0.8
31 0.72
32 0.67
33 0.6
34 0.54
35 0.52
36 0.44
37 0.43
38 0.43
39 0.42
40 0.36
41 0.32
42 0.28
43 0.21
44 0.2
45 0.16
46 0.21
47 0.3
48 0.32
49 0.34
50 0.37
51 0.38
52 0.41
53 0.4
54 0.38
55 0.34
56 0.42
57 0.43
58 0.4
59 0.38
60 0.33
61 0.29
62 0.31
63 0.34
64 0.24
65 0.23
66 0.24
67 0.24
68 0.23
69 0.23
70 0.15
71 0.09
72 0.09
73 0.09
74 0.09
75 0.09
76 0.09
77 0.09
78 0.09
79 0.09
80 0.09
81 0.08
82 0.08
83 0.09
84 0.09
85 0.1
86 0.11
87 0.1
88 0.11
89 0.16
90 0.16
91 0.16
92 0.16
93 0.17
94 0.23
95 0.3
96 0.36
97 0.39
98 0.42
99 0.43
100 0.43
101 0.43
102 0.39
103 0.37
104 0.32
105 0.28
106 0.31
107 0.36
108 0.42
109 0.41
110 0.4
111 0.37