Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R1EBG9

Protein Details
Accession R1EBG9   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
83-109SMTSLKKKTGRVQKKRRGKNTSTITFKHydrophilic
NLS Segment(s)
PositionSequence
88-128KKKTGRVQKKRRGKNTSTITFKNFRTGARKPAAGGKKGGKR
Subcellular Location(s) mito 15.5, cyto_mito 10, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
KEGG npa:UCRNP2_8455  -  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKGARSTARKTNNQALKARVFGPVETARTERLSQKLLELAQQPRPAKTEMEVEKDESNDSVAQDKAPADQAEAMEVDGEKPSMTSLKKKTGRVQKKRRGKNTSTITFKNFRTGARKPAAGGKKGGKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.69
3 0.66
4 0.6
5 0.55
6 0.49
7 0.44
8 0.37
9 0.3
10 0.31
11 0.29
12 0.27
13 0.27
14 0.27
15 0.24
16 0.25
17 0.27
18 0.25
19 0.25
20 0.26
21 0.24
22 0.24
23 0.25
24 0.23
25 0.25
26 0.26
27 0.26
28 0.29
29 0.35
30 0.34
31 0.32
32 0.34
33 0.31
34 0.27
35 0.24
36 0.27
37 0.24
38 0.29
39 0.28
40 0.28
41 0.27
42 0.27
43 0.26
44 0.17
45 0.15
46 0.1
47 0.1
48 0.09
49 0.09
50 0.08
51 0.09
52 0.09
53 0.08
54 0.1
55 0.09
56 0.08
57 0.09
58 0.09
59 0.09
60 0.09
61 0.08
62 0.06
63 0.06
64 0.06
65 0.05
66 0.05
67 0.04
68 0.04
69 0.05
70 0.08
71 0.1
72 0.17
73 0.22
74 0.32
75 0.38
76 0.43
77 0.52
78 0.59
79 0.69
80 0.73
81 0.79
82 0.8
83 0.84
84 0.9
85 0.92
86 0.9
87 0.85
88 0.84
89 0.83
90 0.81
91 0.79
92 0.72
93 0.68
94 0.64
95 0.59
96 0.57
97 0.49
98 0.44
99 0.44
100 0.45
101 0.48
102 0.49
103 0.49
104 0.43
105 0.51
106 0.54
107 0.5
108 0.52