Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R1GFZ1

Protein Details
Accession R1GFZ1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
281-305AHTRTRKEVVERRKARSQKKCGLPFHydrophilic
NLS Segment(s)
PositionSequence
292-295RRKA
Subcellular Location(s) mito 22.5, cyto_mito 13.333, cyto 3, cyto_nucl 2.833
Family & Domain DBs
Gene Ontology GO:0016740  F:transferase activity  
KEGG npa:UCRNP2_2715  -  
Amino Acid Sequences MSKLSIDRKHMKFYETNTIIIENRRWDPVTGASSAMLGTATDITKATTGIFLDPYQEYRKGKATAAAHSAPASRAPSIAESSRTPSPTKSTFSEKPAGPGAKRTNTSSTTATSHSQTPSSAGEGPSTSTSGPLSPTPSSSSDRKKQSLNTAGRMAAASAKSVGAFHSSLFGGLMVDLPLAVTEGMRHLPAAYGDPVRDVGRVTDWKSGAAVAGRNFAWGLAEGMTDIVVQPVRGARQGGAAGAVKGVGKGLVGLGVKTGSAVLGLAAYPGQGIAKTLRGLAHTRTRKEVVERRKARSQKKCGLPF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.51
3 0.48
4 0.4
5 0.41
6 0.38
7 0.37
8 0.35
9 0.29
10 0.29
11 0.32
12 0.32
13 0.3
14 0.31
15 0.32
16 0.32
17 0.27
18 0.26
19 0.22
20 0.2
21 0.19
22 0.16
23 0.1
24 0.06
25 0.06
26 0.07
27 0.07
28 0.08
29 0.08
30 0.09
31 0.09
32 0.1
33 0.09
34 0.09
35 0.09
36 0.1
37 0.12
38 0.11
39 0.14
40 0.15
41 0.18
42 0.2
43 0.26
44 0.26
45 0.27
46 0.33
47 0.33
48 0.33
49 0.36
50 0.35
51 0.34
52 0.38
53 0.36
54 0.31
55 0.29
56 0.29
57 0.23
58 0.23
59 0.2
60 0.14
61 0.13
62 0.13
63 0.14
64 0.17
65 0.18
66 0.18
67 0.17
68 0.22
69 0.25
70 0.26
71 0.25
72 0.24
73 0.28
74 0.29
75 0.32
76 0.31
77 0.35
78 0.38
79 0.42
80 0.46
81 0.41
82 0.4
83 0.42
84 0.42
85 0.34
86 0.38
87 0.39
88 0.38
89 0.4
90 0.4
91 0.38
92 0.37
93 0.4
94 0.34
95 0.3
96 0.26
97 0.27
98 0.25
99 0.22
100 0.23
101 0.21
102 0.19
103 0.17
104 0.17
105 0.15
106 0.16
107 0.16
108 0.13
109 0.13
110 0.12
111 0.14
112 0.12
113 0.12
114 0.1
115 0.08
116 0.08
117 0.08
118 0.09
119 0.09
120 0.11
121 0.11
122 0.12
123 0.14
124 0.17
125 0.2
126 0.24
127 0.31
128 0.35
129 0.41
130 0.42
131 0.42
132 0.43
133 0.48
134 0.52
135 0.48
136 0.44
137 0.41
138 0.38
139 0.35
140 0.32
141 0.23
142 0.16
143 0.12
144 0.08
145 0.07
146 0.07
147 0.06
148 0.07
149 0.07
150 0.07
151 0.07
152 0.07
153 0.08
154 0.08
155 0.08
156 0.08
157 0.07
158 0.05
159 0.05
160 0.05
161 0.03
162 0.03
163 0.03
164 0.03
165 0.03
166 0.03
167 0.03
168 0.03
169 0.03
170 0.04
171 0.05
172 0.05
173 0.05
174 0.05
175 0.06
176 0.06
177 0.08
178 0.09
179 0.1
180 0.1
181 0.11
182 0.12
183 0.12
184 0.12
185 0.1
186 0.09
187 0.12
188 0.16
189 0.18
190 0.22
191 0.21
192 0.21
193 0.21
194 0.2
195 0.17
196 0.15
197 0.16
198 0.11
199 0.14
200 0.13
201 0.13
202 0.13
203 0.12
204 0.11
205 0.08
206 0.08
207 0.06
208 0.06
209 0.06
210 0.06
211 0.06
212 0.05
213 0.05
214 0.05
215 0.05
216 0.05
217 0.06
218 0.08
219 0.09
220 0.11
221 0.12
222 0.11
223 0.14
224 0.14
225 0.14
226 0.14
227 0.14
228 0.12
229 0.11
230 0.12
231 0.09
232 0.08
233 0.08
234 0.05
235 0.04
236 0.05
237 0.05
238 0.07
239 0.08
240 0.08
241 0.08
242 0.08
243 0.08
244 0.08
245 0.08
246 0.04
247 0.04
248 0.04
249 0.04
250 0.04
251 0.04
252 0.04
253 0.04
254 0.04
255 0.04
256 0.04
257 0.05
258 0.04
259 0.06
260 0.08
261 0.11
262 0.12
263 0.14
264 0.16
265 0.18
266 0.22
267 0.27
268 0.35
269 0.41
270 0.44
271 0.49
272 0.51
273 0.52
274 0.59
275 0.62
276 0.62
277 0.65
278 0.69
279 0.7
280 0.77
281 0.82
282 0.83
283 0.84
284 0.84
285 0.83