R1ERL1

UniProt ID: R1ERL1   Organism: Botryosphaeria parva (strain UCR-NP2)
Gene: UCRNP2_3021   Protein: Putative mitochondrial ribosomal protein of the small subunit protein
Length: 132 AA

Protein Details

• Accession: R1ERL1
• Localization Confidence: Low
• Confidence Score: 9.4
• NoLS Segment(s):

  Position	Sequence	Protein Nature
  80-107	AALKARGKGAPKKKRGPPEHKSKGGKKK	Basic

• NLS Segment(s):

  Position	Sequence
  81-107	ALKARGKGAPKKKRGPPEHKSKGGKKK

• Subcellular Location(s): mito 20.5, cyto_mito 11.5, nucl 5
• Family & Domain DBs:
  • InterPro:
    • IPR013219 Ribosomal_S27/S33_mit
  • Gene Ontology:
    • GO:0005739 C:mitochondrion
    • GO:1990904 C:ribonucleoprotein complex
    • GO:0005840 C:ribosome
  • KEGG:
    • npa:UCRNP2_3021 -
  • Pfam:
    • PF08293 MRP-S33
• Amino Acid Sequences: MSVPRQRILALMQAQCKVFNTVFNPEGNRLGTKVLRERLKGPSVAAYYPRRIGTFNDLAKLYPEWEGLDIQEWDRQEKIAALKARGKGAPKKKRGPPEHKSKGGKKK

NoLS Predictions per Residue - Data Table

Residue Number, Score
1, 0.35
2, 0.34
3, 0.33
4, 0.3
5, 0.23
6, 0.23
7, 0.22
8, 0.25
9, 0.27
10, 0.28
11, 0.29
12, 0.27
13, 0.29
14, 0.27
15, 0.24
16, 0.19
17, 0.2
18, 0.2
19, 0.21
20, 0.26
21, 0.3
22, 0.32
23, 0.34
24, 0.36
25, 0.39
26, 0.41
27, 0.37
28, 0.31
29, 0.29
30, 0.27
31, 0.26
32, 0.28
33, 0.25
34, 0.23
35, 0.25
36, 0.26
37, 0.21
38, 0.21
39, 0.21
40, 0.22
41, 0.26
42, 0.24
43, 0.24
44, 0.23
45, 0.23
46, 0.23
47, 0.21
48, 0.16
49, 0.1
50, 0.1
51, 0.08
52, 0.09
53, 0.09
54, 0.08
55, 0.1
56, 0.1
57, 0.09
58, 0.11
59, 0.11
60, 0.12
61, 0.12
62, 0.12
63, 0.11
64, 0.13
65, 0.15
66, 0.19
67, 0.22
68, 0.25
69, 0.3
70, 0.33
71, 0.36
72, 0.36
73, 0.4
74, 0.43
75, 0.5
76, 0.57
77, 0.61
78, 0.68
79, 0.73
80, 0.81
81, 0.86
82, 0.86
83, 0.85
84, 0.86
85, 0.87
86, 0.87
87, 0.89