Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4RMW3

Protein Details
Accession F4RMW3   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
7-37SFGKRHSKTHTSCRRCGRRSFHKQKKTCAACHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, mito_nucl 11, mito 9.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR011331  Ribosomal_L37ae/L37e  
IPR001569  Ribosomal_L37e  
IPR018267  Ribosomal_L37e_CS  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0046872  F:metal ion binding  
GO:0019843  F:rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG mlr:MELLADRAFT_48493  -  
Pfam View protein in Pfam  
PF01907  Ribosomal_L37e  
PROSITE View protein in PROSITE  
PS01077  RIBOSOMAL_L37E  
Amino Acid Sequences MTKGTSSFGKRHSKTHTSCRRCGRRSFHKQKKTCAACGYPAAKTRSYEWGEKAKRRHTTGTGRMRYLKTVSRRFKNGFREGTVAKRKPSTPAST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.69
3 0.72
4 0.69
5 0.75
6 0.79
7 0.81
8 0.77
9 0.79
10 0.78
11 0.78
12 0.82
13 0.85
14 0.85
15 0.85
16 0.85
17 0.85
18 0.85
19 0.79
20 0.73
21 0.67
22 0.58
23 0.5
24 0.5
25 0.43
26 0.36
27 0.36
28 0.33
29 0.29
30 0.28
31 0.28
32 0.29
33 0.3
34 0.29
35 0.27
36 0.34
37 0.38
38 0.43
39 0.47
40 0.47
41 0.51
42 0.52
43 0.53
44 0.51
45 0.55
46 0.59
47 0.64
48 0.6
49 0.57
50 0.59
51 0.55
52 0.51
53 0.45
54 0.42
55 0.41
56 0.47
57 0.53
58 0.55
59 0.62
60 0.64
61 0.68
62 0.71
63 0.7
64 0.65
65 0.6
66 0.58
67 0.53
68 0.58
69 0.61
70 0.55
71 0.51
72 0.52
73 0.49
74 0.51