Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R1EZN8

Protein Details
Accession R1EZN8   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
24-43VTKIKDKLKKLFRREPKPSGBasic
NLS Segment(s)
PositionSequence
25-41TKIKDKLKKLFRREPKP
Subcellular Location(s) nucl 13, mito_nucl 12.833, mito 11.5, cyto_nucl 8.333
Family & Domain DBs
KEGG npa:UCRNP2_121  -  
Amino Acid Sequences MQHTSSPGLKALRSRQKPVNRNFVTKIKDKLKKLFRREPKPSGPLERIAIFGPTWDYFIEMPAQQLHVYQQITLHPIDTPLRLEETLSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.59
3 0.67
4 0.74
5 0.75
6 0.76
7 0.7
8 0.7
9 0.69
10 0.67
11 0.62
12 0.57
13 0.58
14 0.56
15 0.59
16 0.58
17 0.62
18 0.65
19 0.7
20 0.73
21 0.75
22 0.76
23 0.78
24 0.81
25 0.8
26 0.76
27 0.72
28 0.66
29 0.62
30 0.54
31 0.46
32 0.4
33 0.33
34 0.27
35 0.22
36 0.19
37 0.13
38 0.11
39 0.11
40 0.09
41 0.09
42 0.08
43 0.09
44 0.09
45 0.1
46 0.11
47 0.09
48 0.1
49 0.1
50 0.11
51 0.1
52 0.1
53 0.11
54 0.14
55 0.14
56 0.13
57 0.14
58 0.15
59 0.17
60 0.17
61 0.16
62 0.12
63 0.14
64 0.16
65 0.16
66 0.17
67 0.16
68 0.19
69 0.19