Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R1GK03

Protein Details
Accession R1GK03   
Localization Confidence Medium
Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
98-122RLERMGTKKRARRRIRKERREGEGEBasic
NLS Segment(s)
PositionSequence
77-78RR
84-117RGKDDSAAGGERKGRLERMGTKKRARRRIRKERR
190-191SK
Subcellular Location(s) cyto 11.5cyto_nucl 11.5, nucl 10.5, mito 3
Family & Domain DBs
KEGG npa:UCRNP2_4589  -  
Amino Acid Sequences MFDFLFAKPPDQPHLVEEGPYTWAEISGILNRPGTVPAMLDLRTQNPPPLGAYYLPKRLREPRYFIRWRAATPTARRREEEQQRGKDDSAAGGERKGRLERMGTKKRARRRIRKERREGEGEEEVFDEKAALRAQEDLADVVREEEVYGEKAALFAQFAALPERVPSKLRRQGSLARAGERLPAWMRPPSKPRREFTVVRGQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.31
3 0.29
4 0.26
5 0.22
6 0.21
7 0.19
8 0.18
9 0.11
10 0.11
11 0.1
12 0.1
13 0.1
14 0.14
15 0.17
16 0.18
17 0.18
18 0.18
19 0.19
20 0.19
21 0.18
22 0.13
23 0.11
24 0.11
25 0.13
26 0.13
27 0.15
28 0.15
29 0.17
30 0.21
31 0.21
32 0.23
33 0.21
34 0.21
35 0.2
36 0.21
37 0.19
38 0.17
39 0.22
40 0.24
41 0.33
42 0.35
43 0.36
44 0.39
45 0.46
46 0.53
47 0.53
48 0.57
49 0.56
50 0.63
51 0.66
52 0.64
53 0.64
54 0.56
55 0.51
56 0.49
57 0.47
58 0.43
59 0.45
60 0.53
61 0.53
62 0.53
63 0.54
64 0.53
65 0.57
66 0.61
67 0.63
68 0.62
69 0.6
70 0.61
71 0.62
72 0.57
73 0.49
74 0.38
75 0.29
76 0.21
77 0.17
78 0.13
79 0.12
80 0.13
81 0.13
82 0.14
83 0.14
84 0.13
85 0.12
86 0.16
87 0.23
88 0.32
89 0.4
90 0.45
91 0.52
92 0.58
93 0.66
94 0.72
95 0.74
96 0.75
97 0.77
98 0.82
99 0.86
100 0.9
101 0.92
102 0.89
103 0.85
104 0.8
105 0.7
106 0.64
107 0.59
108 0.48
109 0.38
110 0.31
111 0.25
112 0.19
113 0.17
114 0.12
115 0.06
116 0.08
117 0.07
118 0.07
119 0.07
120 0.08
121 0.08
122 0.09
123 0.1
124 0.08
125 0.08
126 0.08
127 0.08
128 0.07
129 0.07
130 0.06
131 0.05
132 0.06
133 0.06
134 0.08
135 0.08
136 0.07
137 0.07
138 0.07
139 0.08
140 0.07
141 0.06
142 0.05
143 0.06
144 0.06
145 0.07
146 0.1
147 0.1
148 0.1
149 0.11
150 0.14
151 0.14
152 0.17
153 0.21
154 0.29
155 0.37
156 0.41
157 0.42
158 0.46
159 0.53
160 0.56
161 0.61
162 0.55
163 0.49
164 0.47
165 0.44
166 0.42
167 0.34
168 0.32
169 0.24
170 0.24
171 0.24
172 0.31
173 0.34
174 0.38
175 0.48
176 0.54
177 0.63
178 0.67
179 0.69
180 0.71
181 0.75
182 0.71
183 0.69