Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R1EK37

Protein Details
Accession R1EK37    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MSAQAPPRKRARKSSDPDSTPRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 9.5, mito 9, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR046797  PDDEXK_12  
KEGG npa:UCRNP2_5351  -  
Pfam View protein in Pfam  
PF20516  PDDEXK_12  
Amino Acid Sequences MSAQAPPRKRARKSSDPDSTPRLTRSLQYPAAIQSHSHSQPRSQPRSTSPVKSIPDLKATNLRLAYIPLSDALDDGLLDAGLHRLYTNELLECEMLTGVVPRPTRDCLDTLHRPPRLRDHNFRDDARPALDVQLELRDVREIEQRSLDTEAHIFPKDLVPRDSQGLLTESKLVDYCIFLRCPQLEPALLAALSAEQPLSVPQSANHTALVPLRYQPIAVSIETKTPSGNDDYARAQLAVWGSAHLERLRRLRRGARPPTLPLLLVSGVDWDLYFVRAADDGPAGGVQMLGSHRLGDTKSVVSIYKLLAGLRALARWAETEYREWWRELLAQTTTRNMSLPLAAVGGDGSSGPDSAPPDGADAETTLPDGRDPETTTATSHLSAD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.84
3 0.8
4 0.8
5 0.76
6 0.72
7 0.65
8 0.58
9 0.52
10 0.44
11 0.42
12 0.41
13 0.42
14 0.41
15 0.38
16 0.38
17 0.38
18 0.39
19 0.35
20 0.3
21 0.25
22 0.3
23 0.33
24 0.36
25 0.33
26 0.35
27 0.44
28 0.54
29 0.6
30 0.55
31 0.56
32 0.57
33 0.65
34 0.66
35 0.63
36 0.58
37 0.58
38 0.56
39 0.56
40 0.56
41 0.5
42 0.52
43 0.47
44 0.44
45 0.44
46 0.43
47 0.44
48 0.38
49 0.36
50 0.28
51 0.28
52 0.26
53 0.18
54 0.17
55 0.12
56 0.12
57 0.11
58 0.1
59 0.09
60 0.07
61 0.06
62 0.06
63 0.05
64 0.04
65 0.04
66 0.04
67 0.05
68 0.05
69 0.05
70 0.05
71 0.05
72 0.07
73 0.1
74 0.11
75 0.11
76 0.11
77 0.13
78 0.13
79 0.12
80 0.11
81 0.08
82 0.07
83 0.06
84 0.07
85 0.08
86 0.12
87 0.13
88 0.14
89 0.17
90 0.2
91 0.22
92 0.23
93 0.22
94 0.21
95 0.29
96 0.36
97 0.42
98 0.47
99 0.5
100 0.5
101 0.52
102 0.58
103 0.6
104 0.6
105 0.62
106 0.62
107 0.67
108 0.7
109 0.7
110 0.64
111 0.56
112 0.5
113 0.41
114 0.33
115 0.24
116 0.2
117 0.18
118 0.14
119 0.12
120 0.12
121 0.11
122 0.1
123 0.1
124 0.09
125 0.09
126 0.11
127 0.16
128 0.16
129 0.17
130 0.19
131 0.19
132 0.2
133 0.22
134 0.2
135 0.14
136 0.14
137 0.14
138 0.14
139 0.15
140 0.13
141 0.11
142 0.15
143 0.18
144 0.19
145 0.2
146 0.19
147 0.2
148 0.22
149 0.22
150 0.18
151 0.16
152 0.15
153 0.14
154 0.12
155 0.13
156 0.1
157 0.1
158 0.1
159 0.1
160 0.08
161 0.08
162 0.09
163 0.1
164 0.1
165 0.1
166 0.13
167 0.13
168 0.15
169 0.15
170 0.15
171 0.13
172 0.13
173 0.13
174 0.11
175 0.1
176 0.08
177 0.06
178 0.05
179 0.05
180 0.04
181 0.03
182 0.03
183 0.03
184 0.04
185 0.05
186 0.06
187 0.06
188 0.06
189 0.12
190 0.15
191 0.15
192 0.15
193 0.14
194 0.14
195 0.16
196 0.17
197 0.12
198 0.11
199 0.12
200 0.11
201 0.11
202 0.1
203 0.11
204 0.12
205 0.11
206 0.12
207 0.12
208 0.15
209 0.16
210 0.16
211 0.13
212 0.11
213 0.13
214 0.13
215 0.15
216 0.12
217 0.14
218 0.15
219 0.17
220 0.17
221 0.15
222 0.12
223 0.12
224 0.12
225 0.1
226 0.09
227 0.08
228 0.08
229 0.09
230 0.11
231 0.11
232 0.13
233 0.15
234 0.24
235 0.3
236 0.33
237 0.38
238 0.45
239 0.53
240 0.61
241 0.67
242 0.66
243 0.64
244 0.64
245 0.63
246 0.55
247 0.46
248 0.35
249 0.28
250 0.21
251 0.17
252 0.13
253 0.09
254 0.08
255 0.08
256 0.07
257 0.06
258 0.06
259 0.06
260 0.06
261 0.05
262 0.06
263 0.06
264 0.07
265 0.07
266 0.07
267 0.06
268 0.07
269 0.06
270 0.06
271 0.05
272 0.05
273 0.04
274 0.05
275 0.06
276 0.08
277 0.08
278 0.08
279 0.08
280 0.1
281 0.11
282 0.11
283 0.14
284 0.13
285 0.14
286 0.14
287 0.15
288 0.14
289 0.16
290 0.14
291 0.15
292 0.15
293 0.14
294 0.14
295 0.14
296 0.16
297 0.15
298 0.15
299 0.12
300 0.11
301 0.12
302 0.11
303 0.14
304 0.15
305 0.16
306 0.18
307 0.22
308 0.29
309 0.31
310 0.3
311 0.28
312 0.26
313 0.29
314 0.28
315 0.29
316 0.26
317 0.28
318 0.29
319 0.33
320 0.33
321 0.28
322 0.27
323 0.23
324 0.2
325 0.17
326 0.17
327 0.13
328 0.11
329 0.11
330 0.1
331 0.09
332 0.07
333 0.06
334 0.05
335 0.05
336 0.06
337 0.06
338 0.06
339 0.08
340 0.1
341 0.12
342 0.13
343 0.12
344 0.13
345 0.14
346 0.15
347 0.13
348 0.12
349 0.12
350 0.11
351 0.12
352 0.11
353 0.11
354 0.11
355 0.12
356 0.13
357 0.15
358 0.18
359 0.21
360 0.24
361 0.25
362 0.26
363 0.27
364 0.27