Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4R7D7

Protein Details
Accession F4R7D7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MPHKPVKKRFRIFRRVNTSRCLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, cyto 2
Family & Domain DBs
KEGG mlr:MELLADRAFT_102157  -  
Amino Acid Sequences MPHKPVKKRFRIFRRVNTSRCLSRPITVPAWAAPGIGGSKRYSLYGQKLLKITPTVTKVFEAKTSRAMTLTPYKERATYSEQHKVGTILGCDTGSHIDMYKDTAAYVTF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.89
3 0.83
4 0.78
5 0.75
6 0.7
7 0.62
8 0.57
9 0.48
10 0.43
11 0.44
12 0.43
13 0.38
14 0.33
15 0.32
16 0.27
17 0.28
18 0.24
19 0.19
20 0.13
21 0.11
22 0.1
23 0.1
24 0.11
25 0.09
26 0.1
27 0.11
28 0.12
29 0.13
30 0.16
31 0.2
32 0.27
33 0.28
34 0.3
35 0.3
36 0.29
37 0.29
38 0.26
39 0.22
40 0.18
41 0.19
42 0.17
43 0.17
44 0.18
45 0.18
46 0.18
47 0.22
48 0.21
49 0.19
50 0.24
51 0.24
52 0.24
53 0.23
54 0.22
55 0.21
56 0.26
57 0.3
58 0.27
59 0.29
60 0.29
61 0.3
62 0.31
63 0.31
64 0.29
65 0.31
66 0.35
67 0.4
68 0.4
69 0.39
70 0.39
71 0.36
72 0.32
73 0.28
74 0.21
75 0.13
76 0.14
77 0.13
78 0.12
79 0.13
80 0.12
81 0.11
82 0.11
83 0.11
84 0.11
85 0.11
86 0.15
87 0.15
88 0.13
89 0.12