Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R1H284

Protein Details
Accession R1H284    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
110-130GESQKKIKGAKKQQQKQVEEVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 12.5, mito 6, cyto 5.5
Family & Domain DBs
KEGG npa:UCRNP2_692  -  
Amino Acid Sequences MSSKQQVARRAAADEQQLSQPQVEAREQYASAEAKAGLNLNIFAALSGSMFQRSKKTTDTAADGSSRTVEHTDTAAQAKGAGHGNLSAVGSAKAESRDRAVGNGAIEAVGESQKKIKGAKKQQQKQVEEVDHLGIGAWEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.33
3 0.31
4 0.31
5 0.29
6 0.26
7 0.23
8 0.19
9 0.2
10 0.2
11 0.18
12 0.18
13 0.19
14 0.19
15 0.18
16 0.21
17 0.18
18 0.16
19 0.16
20 0.14
21 0.12
22 0.13
23 0.13
24 0.09
25 0.09
26 0.09
27 0.08
28 0.07
29 0.07
30 0.06
31 0.05
32 0.04
33 0.04
34 0.05
35 0.05
36 0.08
37 0.09
38 0.1
39 0.14
40 0.16
41 0.19
42 0.21
43 0.22
44 0.23
45 0.25
46 0.28
47 0.25
48 0.25
49 0.23
50 0.21
51 0.19
52 0.16
53 0.13
54 0.1
55 0.08
56 0.07
57 0.07
58 0.07
59 0.08
60 0.08
61 0.1
62 0.09
63 0.08
64 0.09
65 0.08
66 0.09
67 0.1
68 0.09
69 0.08
70 0.08
71 0.08
72 0.08
73 0.08
74 0.06
75 0.05
76 0.06
77 0.06
78 0.06
79 0.07
80 0.09
81 0.11
82 0.11
83 0.13
84 0.17
85 0.17
86 0.17
87 0.18
88 0.17
89 0.16
90 0.16
91 0.13
92 0.1
93 0.09
94 0.08
95 0.07
96 0.08
97 0.08
98 0.08
99 0.11
100 0.13
101 0.16
102 0.22
103 0.27
104 0.36
105 0.47
106 0.56
107 0.64
108 0.71
109 0.79
110 0.83
111 0.81
112 0.77
113 0.75
114 0.69
115 0.61
116 0.54
117 0.46
118 0.36
119 0.31
120 0.25