Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R1EK42

Protein Details
Accession R1EK42    Localization Confidence High Confidence Score 20
NoLS Segment(s)
PositionSequenceProtein Nature
3-26AAQVRRAEKKDLKKMEKMQRKGVKBasic
NLS Segment(s)
PositionSequence
7-30RRAEKKDLKKMEKMQRKGVKERNK
49-89AERKAERDLEKKKAQKDPKERVKIEKELQKEREKLEKELRK
Subcellular Location(s) nucl 26
Family & Domain DBs
KEGG npa:UCRNP2_5349  -  
Amino Acid Sequences MGAAQVRRAEKKDLKKMEKMQRKGVKERNKGVQDLEKEMVKIEEDMEKAERKAERDLEKKKAQKDPKERVKIEKELQKEREKLEKELRKVLEDSEKDIQKEDKKMEKEQAKKTGKLLWVLITNLPGGEMLPQSEEQMSPDSELI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.74
3 0.81
4 0.83
5 0.85
6 0.8
7 0.8
8 0.78
9 0.78
10 0.79
11 0.79
12 0.79
13 0.78
14 0.79
15 0.78
16 0.74
17 0.68
18 0.62
19 0.6
20 0.52
21 0.48
22 0.43
23 0.34
24 0.3
25 0.29
26 0.25
27 0.18
28 0.15
29 0.11
30 0.12
31 0.11
32 0.13
33 0.14
34 0.16
35 0.15
36 0.19
37 0.19
38 0.18
39 0.22
40 0.27
41 0.33
42 0.4
43 0.45
44 0.49
45 0.56
46 0.59
47 0.61
48 0.63
49 0.64
50 0.65
51 0.7
52 0.72
53 0.75
54 0.79
55 0.75
56 0.73
57 0.7
58 0.67
59 0.62
60 0.57
61 0.52
62 0.5
63 0.54
64 0.53
65 0.5
66 0.47
67 0.49
68 0.46
69 0.46
70 0.49
71 0.49
72 0.46
73 0.51
74 0.49
75 0.43
76 0.41
77 0.39
78 0.37
79 0.31
80 0.33
81 0.32
82 0.33
83 0.31
84 0.32
85 0.35
86 0.31
87 0.36
88 0.37
89 0.38
90 0.4
91 0.45
92 0.52
93 0.55
94 0.59
95 0.62
96 0.67
97 0.65
98 0.63
99 0.61
100 0.59
101 0.53
102 0.48
103 0.41
104 0.34
105 0.31
106 0.31
107 0.29
108 0.23
109 0.2
110 0.16
111 0.15
112 0.11
113 0.08
114 0.09
115 0.08
116 0.08
117 0.1
118 0.11
119 0.12
120 0.13
121 0.14
122 0.13
123 0.16
124 0.16