Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R1GIG8

Protein Details
Accession R1GIG8   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-33AKSKNSSQHNQSKKAHRNGIKKPKTNRYPSLKHydrophilic
NLS Segment(s)
PositionSequence
14-44KKAHRNGIKKPKTNRYPSLKGVDPKFRRNHR
Subcellular Location(s) nucl 20, cyto_nucl 12.333, mito_nucl 12.333, mito 3.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG npa:UCRNP2_5129  -  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNSSQHNQSKKAHRNGIKKPKTNRYPSLKGVDPKFRRNHRHALHGTMRALVRIPWISKKHVRTFMADTNGNTQKEVKEGKREAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.81
3 0.82
4 0.8
5 0.81
6 0.83
7 0.86
8 0.85
9 0.83
10 0.83
11 0.84
12 0.85
13 0.83
14 0.81
15 0.79
16 0.76
17 0.73
18 0.7
19 0.64
20 0.6
21 0.57
22 0.58
23 0.53
24 0.54
25 0.57
26 0.6
27 0.62
28 0.62
29 0.67
30 0.6
31 0.65
32 0.58
33 0.57
34 0.54
35 0.5
36 0.45
37 0.38
38 0.35
39 0.26
40 0.24
41 0.17
42 0.15
43 0.14
44 0.15
45 0.2
46 0.23
47 0.29
48 0.36
49 0.43
50 0.48
51 0.55
52 0.55
53 0.52
54 0.56
55 0.57
56 0.56
57 0.51
58 0.44
59 0.43
60 0.48
61 0.43
62 0.38
63 0.33
64 0.27
65 0.31
66 0.38
67 0.35
68 0.39