Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R1GGN3

Protein Details
Accession R1GGN3   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MPKEKTTRKAKASKADGKKKKDPNAPKRGLSBasic
NLS Segment(s)
PositionSequence
5-28KTTRKAKASKADGKKKKDPNAPKR
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
KEGG npa:UCRNP2_2405  -  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKEKTTRKAKASKADGKKKKDPNAPKRGLSAYMFFANDMRDKVREENPGIKFGEVGKILGERWKALSEKQRAPYEAKAANDKKRYEDEKAAYNAAGDDEDETSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.85
3 0.84
4 0.83
5 0.85
6 0.84
7 0.83
8 0.83
9 0.84
10 0.84
11 0.86
12 0.83
13 0.76
14 0.71
15 0.64
16 0.57
17 0.48
18 0.39
19 0.31
20 0.27
21 0.24
22 0.2
23 0.18
24 0.16
25 0.16
26 0.14
27 0.13
28 0.12
29 0.14
30 0.17
31 0.21
32 0.24
33 0.26
34 0.32
35 0.32
36 0.34
37 0.33
38 0.29
39 0.25
40 0.2
41 0.21
42 0.14
43 0.12
44 0.09
45 0.09
46 0.1
47 0.12
48 0.12
49 0.09
50 0.1
51 0.13
52 0.13
53 0.17
54 0.26
55 0.31
56 0.37
57 0.44
58 0.46
59 0.46
60 0.49
61 0.48
62 0.46
63 0.43
64 0.38
65 0.41
66 0.43
67 0.5
68 0.52
69 0.5
70 0.48
71 0.53
72 0.56
73 0.53
74 0.55
75 0.5
76 0.51
77 0.53
78 0.5
79 0.41
80 0.36
81 0.3
82 0.22
83 0.19
84 0.12
85 0.1