Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R1GIC5

Protein Details
Accession R1GIC5    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
322-345MICTYDKVQRVKNKWKCTLKDGVLHydrophilic
NLS Segment(s)
PositionSequence
260-263KKRR
Subcellular Location(s) nucl 19.5, cyto_nucl 12, cyto 3.5, plas 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR004855  TFIIA_asu/bsu  
IPR009088  TFIIA_b-brl  
Gene Ontology GO:0005672  C:transcription factor TFIIA complex  
GO:0006367  P:transcription initiation at RNA polymerase II promoter  
KEGG npa:UCRNP2_5206  -  
Pfam View protein in Pfam  
PF03153  TFIIA  
CDD cd07976  TFIIA_alpha_beta_like  
Amino Acid Sequences MSNQITGGVFSQIIDRVVQSSQNDFEESGVDQQTLQELKELWQKKLSVLHVAQMPWDPQPAQPQISNPPTVPSNDAKQPQMPQQMPPASAPPPNTQYGSGVRVKQEAGNGYENNMPSYNMNGYNIPNGNVAQQRAAALLQQNYGAQAQASIASAFPQQNNVGLPGQQQPQQQQQQRPMNLQMPPNRQQQAQQQHQPPQQQGPPPGQPQQQQQSSLYAAQTDGSGDAEEQWKSLVAFEQRMDVIESGLMQPIEELPSSKSKKRRAPAAAGPSGTSSIPQLDGELGLEDEKEENDDEAINSDLDDSDEEQIQENDDDGPQGDTMICTYDKVQRVKNKWKCTLKDGVLSTGGKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.13
4 0.14
5 0.18
6 0.18
7 0.2
8 0.22
9 0.24
10 0.24
11 0.23
12 0.22
13 0.19
14 0.19
15 0.19
16 0.17
17 0.15
18 0.13
19 0.14
20 0.18
21 0.17
22 0.16
23 0.14
24 0.14
25 0.18
26 0.27
27 0.3
28 0.28
29 0.32
30 0.33
31 0.34
32 0.4
33 0.39
34 0.39
35 0.36
36 0.38
37 0.37
38 0.36
39 0.34
40 0.29
41 0.28
42 0.21
43 0.23
44 0.19
45 0.17
46 0.25
47 0.27
48 0.28
49 0.28
50 0.3
51 0.36
52 0.4
53 0.4
54 0.32
55 0.31
56 0.3
57 0.3
58 0.31
59 0.26
60 0.27
61 0.31
62 0.35
63 0.34
64 0.36
65 0.38
66 0.41
67 0.47
68 0.43
69 0.39
70 0.44
71 0.45
72 0.42
73 0.4
74 0.35
75 0.29
76 0.31
77 0.32
78 0.28
79 0.28
80 0.29
81 0.29
82 0.27
83 0.28
84 0.27
85 0.29
86 0.28
87 0.27
88 0.26
89 0.26
90 0.26
91 0.25
92 0.24
93 0.22
94 0.22
95 0.24
96 0.23
97 0.23
98 0.25
99 0.24
100 0.22
101 0.2
102 0.17
103 0.12
104 0.15
105 0.15
106 0.13
107 0.14
108 0.14
109 0.15
110 0.19
111 0.19
112 0.18
113 0.16
114 0.15
115 0.18
116 0.19
117 0.18
118 0.14
119 0.14
120 0.13
121 0.13
122 0.13
123 0.1
124 0.11
125 0.11
126 0.11
127 0.11
128 0.11
129 0.11
130 0.11
131 0.09
132 0.06
133 0.05
134 0.05
135 0.05
136 0.06
137 0.05
138 0.05
139 0.05
140 0.08
141 0.09
142 0.09
143 0.1
144 0.1
145 0.11
146 0.11
147 0.12
148 0.11
149 0.1
150 0.12
151 0.14
152 0.15
153 0.18
154 0.2
155 0.21
156 0.28
157 0.35
158 0.39
159 0.4
160 0.47
161 0.5
162 0.5
163 0.5
164 0.45
165 0.42
166 0.4
167 0.41
168 0.38
169 0.38
170 0.41
171 0.45
172 0.44
173 0.4
174 0.4
175 0.43
176 0.46
177 0.46
178 0.49
179 0.48
180 0.54
181 0.58
182 0.58
183 0.51
184 0.46
185 0.44
186 0.4
187 0.38
188 0.35
189 0.36
190 0.35
191 0.39
192 0.38
193 0.37
194 0.4
195 0.44
196 0.42
197 0.4
198 0.37
199 0.35
200 0.32
201 0.3
202 0.23
203 0.16
204 0.13
205 0.11
206 0.1
207 0.08
208 0.06
209 0.05
210 0.05
211 0.05
212 0.06
213 0.08
214 0.08
215 0.08
216 0.08
217 0.08
218 0.08
219 0.09
220 0.11
221 0.11
222 0.13
223 0.14
224 0.16
225 0.15
226 0.16
227 0.17
228 0.13
229 0.11
230 0.09
231 0.09
232 0.08
233 0.09
234 0.08
235 0.06
236 0.06
237 0.07
238 0.08
239 0.08
240 0.08
241 0.09
242 0.19
243 0.23
244 0.29
245 0.37
246 0.45
247 0.53
248 0.59
249 0.67
250 0.65
251 0.69
252 0.73
253 0.74
254 0.7
255 0.61
256 0.55
257 0.46
258 0.4
259 0.31
260 0.22
261 0.14
262 0.1
263 0.11
264 0.1
265 0.09
266 0.09
267 0.09
268 0.09
269 0.09
270 0.08
271 0.07
272 0.07
273 0.07
274 0.07
275 0.07
276 0.08
277 0.08
278 0.08
279 0.08
280 0.09
281 0.09
282 0.1
283 0.11
284 0.09
285 0.09
286 0.09
287 0.08
288 0.08
289 0.09
290 0.09
291 0.1
292 0.12
293 0.12
294 0.14
295 0.14
296 0.15
297 0.14
298 0.13
299 0.12
300 0.11
301 0.11
302 0.1
303 0.11
304 0.09
305 0.1
306 0.09
307 0.08
308 0.08
309 0.11
310 0.1
311 0.1
312 0.13
313 0.2
314 0.27
315 0.32
316 0.4
317 0.47
318 0.57
319 0.67
320 0.74
321 0.77
322 0.8
323 0.85
324 0.83
325 0.8
326 0.8
327 0.75
328 0.73
329 0.66
330 0.6
331 0.55