Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R1GQF9

Protein Details
Accession R1GQF9    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
38-57TEPQIKKYWREKERARKVPRBasic
83-104IGNARIKRWKRAHRLGLKPPIEHydrophilic
NLS Segment(s)
PositionSequence
89-95KRWKRAH
Subcellular Location(s) nucl 11, mito 5, pero 5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR007218  DNA_pol_delta_4  
Gene Ontology GO:0006260  P:DNA replication  
GO:0000731  P:DNA synthesis involved in DNA repair  
KEGG npa:UCRNP2_5041  -  
Pfam View protein in Pfam  
PF04081  DNA_pol_delta_4  
Amino Acid Sequences MSAWEDLTTSELAIAQQSKKEAAQAELTPEEKAASRITEPQIKKYWREKERARKVPRVHQQDLSVHEKVLREFDTSGQYGPCIGNARIKRWKRAHRLGLKPPIEVLAVLLKEGRDNTKAQRAHVDELLGSRFVET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.16
4 0.17
5 0.19
6 0.19
7 0.22
8 0.21
9 0.2
10 0.23
11 0.22
12 0.25
13 0.26
14 0.27
15 0.23
16 0.21
17 0.2
18 0.15
19 0.16
20 0.12
21 0.11
22 0.12
23 0.17
24 0.21
25 0.29
26 0.29
27 0.34
28 0.41
29 0.42
30 0.47
31 0.51
32 0.57
33 0.55
34 0.63
35 0.66
36 0.7
37 0.78
38 0.81
39 0.79
40 0.78
41 0.77
42 0.78
43 0.78
44 0.75
45 0.68
46 0.6
47 0.57
48 0.51
49 0.51
50 0.46
51 0.37
52 0.28
53 0.27
54 0.24
55 0.21
56 0.2
57 0.16
58 0.12
59 0.12
60 0.14
61 0.15
62 0.15
63 0.15
64 0.13
65 0.12
66 0.11
67 0.11
68 0.11
69 0.11
70 0.11
71 0.17
72 0.19
73 0.26
74 0.35
75 0.38
76 0.46
77 0.53
78 0.62
79 0.65
80 0.73
81 0.77
82 0.77
83 0.84
84 0.84
85 0.84
86 0.76
87 0.66
88 0.56
89 0.47
90 0.38
91 0.28
92 0.2
93 0.15
94 0.13
95 0.13
96 0.13
97 0.12
98 0.13
99 0.15
100 0.17
101 0.14
102 0.18
103 0.23
104 0.32
105 0.34
106 0.34
107 0.42
108 0.43
109 0.45
110 0.44
111 0.4
112 0.32
113 0.32
114 0.32
115 0.24