Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R1GIB3

Protein Details
Accession R1GIB3    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
58-79AYRDCKKQWMEARKAEKRKQSGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 8pero 8, cyto 5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009069  Cys_alpha_HP_mot_SF  
KEGG npa:UCRNP2_5238  -  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MAGDGKPETPWTESAAATFDGKQYSQYFDPCQEAASKSLRCLHRNGGDRDMCSDYFQAYRDCKKQWMEARKAEKRKQSGLW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.18
4 0.17
5 0.16
6 0.14
7 0.13
8 0.13
9 0.15
10 0.14
11 0.18
12 0.18
13 0.2
14 0.21
15 0.22
16 0.24
17 0.21
18 0.21
19 0.18
20 0.17
21 0.17
22 0.2
23 0.18
24 0.17
25 0.24
26 0.27
27 0.27
28 0.28
29 0.31
30 0.34
31 0.4
32 0.42
33 0.43
34 0.41
35 0.4
36 0.41
37 0.38
38 0.31
39 0.25
40 0.23
41 0.16
42 0.16
43 0.17
44 0.18
45 0.2
46 0.26
47 0.29
48 0.31
49 0.36
50 0.38
51 0.45
52 0.51
53 0.56
54 0.59
55 0.63
56 0.72
57 0.76
58 0.82
59 0.82
60 0.82
61 0.78