Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M7TBC4

Protein Details
Accession M7TBC4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
51-81ATEKPEQKKAKEDKKAKKKNKSGGTKPPAQRBasic
NLS Segment(s)
PositionSequence
56-81EQKKAKEDKKAKKKNKSGGTKPPAQR
Subcellular Location(s) cyto 11.5, E.R. 7, cyto_nucl 6.5, mito 4, extr 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG ela:UCREL1_5845  -  
Amino Acid Sequences MSGQFGFMSKIGATDEAVAVLNDQPFIFTLLVVVLVICILECVLIWYIGYATEKPEQKKAKEDKKAKKKNKSGGTKPPAQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.09
4 0.09
5 0.08
6 0.08
7 0.09
8 0.09
9 0.08
10 0.08
11 0.07
12 0.07
13 0.1
14 0.09
15 0.07
16 0.07
17 0.06
18 0.06
19 0.06
20 0.05
21 0.03
22 0.02
23 0.02
24 0.02
25 0.02
26 0.02
27 0.02
28 0.02
29 0.03
30 0.03
31 0.04
32 0.04
33 0.04
34 0.04
35 0.05
36 0.06
37 0.06
38 0.08
39 0.14
40 0.19
41 0.21
42 0.29
43 0.35
44 0.36
45 0.46
46 0.53
47 0.58
48 0.65
49 0.73
50 0.76
51 0.81
52 0.9
53 0.91
54 0.91
55 0.91
56 0.91
57 0.91
58 0.91
59 0.89
60 0.89
61 0.87