Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7SLW6

Protein Details
Accession M7SLW6   
Localization Confidence Low
Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MNITDKRETKRNKTYSKPHIPPSHGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10, mito 7, cyto 7, cyto_mito 7
Family & Domain DBs
KEGG ela:UCREL1_7866  -  
Amino Acid Sequences MNITDKRETKRNKTYSKPHIPPSHGIPGPDIDGALPPQQPARKADVGDVGEPGADQVVADDLELRRGPEHGHAQEEDQPVEVAELQGYETGVRVVGWWCG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.85
3 0.87
4 0.84
5 0.82
6 0.8
7 0.76
8 0.7
9 0.66
10 0.65
11 0.55
12 0.48
13 0.4
14 0.33
15 0.3
16 0.26
17 0.19
18 0.1
19 0.1
20 0.11
21 0.11
22 0.1
23 0.09
24 0.12
25 0.14
26 0.16
27 0.18
28 0.22
29 0.23
30 0.23
31 0.24
32 0.25
33 0.25
34 0.23
35 0.21
36 0.15
37 0.12
38 0.11
39 0.1
40 0.05
41 0.03
42 0.02
43 0.02
44 0.03
45 0.03
46 0.03
47 0.05
48 0.05
49 0.08
50 0.08
51 0.09
52 0.09
53 0.09
54 0.11
55 0.14
56 0.22
57 0.21
58 0.24
59 0.24
60 0.26
61 0.33
62 0.34
63 0.29
64 0.22
65 0.2
66 0.17
67 0.17
68 0.15
69 0.09
70 0.07
71 0.06
72 0.06
73 0.06
74 0.07
75 0.06
76 0.06
77 0.06
78 0.06
79 0.06
80 0.07