Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M7SYK3

Protein Details
Accession M7SYK3    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MPTRPHRRRREKKLMTMDEVNEBasic
NLS Segment(s)
PositionSequence
6-12HRRRREK
Subcellular Location(s) mito 16, nucl 8.5, cyto_nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR001841  Znf_RING  
IPR013083  Znf_RING/FYVE/PHD  
KEGG ela:UCREL1_3569  -  
Pfam View protein in Pfam  
PF17123  zf-RING_11  
Amino Acid Sequences MPTRPHRRRREKKLMTMDEVNEKFPMVKYKTWVAGRAREGLPTAGGVSRPGSRANSVRSVEGIVPELPPKERDSIDEPRRTSASPATVDEKPTDVPLTHADGTPGAAAATAETTDKDDTNNDNILTHTQTVQTLASGITKGQDGHASDDEDDEQIDAALPPELMGTSGDTCAICIDTLEDDDDVRGLTCGHAFHAAARR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.86
3 0.81
4 0.73
5 0.72
6 0.62
7 0.53
8 0.42
9 0.35
10 0.29
11 0.25
12 0.3
13 0.24
14 0.26
15 0.29
16 0.34
17 0.41
18 0.42
19 0.47
20 0.43
21 0.47
22 0.47
23 0.49
24 0.44
25 0.38
26 0.36
27 0.3
28 0.25
29 0.18
30 0.16
31 0.11
32 0.11
33 0.1
34 0.11
35 0.12
36 0.13
37 0.15
38 0.15
39 0.18
40 0.22
41 0.26
42 0.31
43 0.3
44 0.3
45 0.28
46 0.28
47 0.25
48 0.21
49 0.19
50 0.12
51 0.12
52 0.12
53 0.13
54 0.12
55 0.13
56 0.14
57 0.15
58 0.15
59 0.18
60 0.23
61 0.32
62 0.39
63 0.44
64 0.43
65 0.42
66 0.43
67 0.4
68 0.36
69 0.28
70 0.25
71 0.2
72 0.21
73 0.23
74 0.22
75 0.23
76 0.22
77 0.2
78 0.16
79 0.15
80 0.13
81 0.09
82 0.1
83 0.1
84 0.14
85 0.13
86 0.13
87 0.12
88 0.12
89 0.12
90 0.1
91 0.09
92 0.04
93 0.04
94 0.03
95 0.03
96 0.03
97 0.03
98 0.03
99 0.04
100 0.05
101 0.06
102 0.07
103 0.07
104 0.09
105 0.11
106 0.14
107 0.15
108 0.14
109 0.14
110 0.14
111 0.15
112 0.15
113 0.13
114 0.11
115 0.1
116 0.1
117 0.11
118 0.1
119 0.09
120 0.08
121 0.07
122 0.07
123 0.07
124 0.07
125 0.06
126 0.07
127 0.07
128 0.08
129 0.11
130 0.11
131 0.16
132 0.18
133 0.18
134 0.18
135 0.19
136 0.19
137 0.15
138 0.14
139 0.1
140 0.08
141 0.06
142 0.06
143 0.05
144 0.05
145 0.05
146 0.05
147 0.05
148 0.05
149 0.05
150 0.05
151 0.06
152 0.07
153 0.08
154 0.08
155 0.1
156 0.09
157 0.1
158 0.1
159 0.1
160 0.08
161 0.07
162 0.08
163 0.08
164 0.09
165 0.1
166 0.1
167 0.09
168 0.1
169 0.1
170 0.09
171 0.08
172 0.07
173 0.06
174 0.07
175 0.09
176 0.09
177 0.11
178 0.13
179 0.13