Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M7TCV7

Protein Details
Accession M7TCV7    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MTTPKTASPKKASPKKQHIARRAQALTHydrophilic
NLS Segment(s)
PositionSequence
10-16KKASPKK
Subcellular Location(s) mito 15.5, cyto_mito 10.5, nucl 7, cyto 4.5
Family & Domain DBs
KEGG ela:UCREL1_8526  -  
Amino Acid Sequences MTTPKTASPKKASPKKQHIARRAQALTLHGVGISFAEIKKKTGYSKSSFYELRQKAIGRGYVDGGPVLDEHVIDGKRTGRPTKAAGKTDQQAVNEAVNTTTKPFQLEDVQLLARAESSTTSTTAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.86
3 0.88
4 0.88
5 0.87
6 0.87
7 0.83
8 0.81
9 0.72
10 0.64
11 0.57
12 0.49
13 0.42
14 0.32
15 0.26
16 0.16
17 0.15
18 0.12
19 0.1
20 0.09
21 0.06
22 0.06
23 0.11
24 0.11
25 0.13
26 0.15
27 0.18
28 0.21
29 0.27
30 0.33
31 0.32
32 0.38
33 0.39
34 0.41
35 0.4
36 0.39
37 0.42
38 0.37
39 0.35
40 0.31
41 0.3
42 0.27
43 0.28
44 0.29
45 0.19
46 0.19
47 0.18
48 0.16
49 0.15
50 0.13
51 0.1
52 0.08
53 0.06
54 0.06
55 0.05
56 0.04
57 0.04
58 0.07
59 0.07
60 0.07
61 0.09
62 0.11
63 0.14
64 0.17
65 0.2
66 0.19
67 0.22
68 0.27
69 0.36
70 0.41
71 0.41
72 0.42
73 0.44
74 0.45
75 0.48
76 0.46
77 0.37
78 0.32
79 0.3
80 0.28
81 0.23
82 0.21
83 0.15
84 0.13
85 0.13
86 0.13
87 0.14
88 0.13
89 0.15
90 0.15
91 0.17
92 0.21
93 0.23
94 0.23
95 0.24
96 0.23
97 0.23
98 0.23
99 0.19
100 0.15
101 0.13
102 0.11
103 0.09
104 0.12
105 0.12