Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7T1W9

Protein Details
Accession M7T1W9   
Localization Confidence High
Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
17-41MGEDRKRKVAKQREKEKARNDNNVTHydrophilic
NLS Segment(s)
PositionSequence
3-35KGKAKGKAKGKRMGMGEDRKRKVAKQREKEKAR
Subcellular Location(s) nucl 19, mito 7
Family & Domain DBs
KEGG ela:UCREL1_2433  -  
Amino Acid Sequences MGKGKAKGKAKGKRMGMGEDRKRKVAKQREKEKARNDNNVTTGLDTATAAPAGHDDNGKDKDKSKSKTPLVRFGNDANERRLFESIEIAQRAIDAIKRGVDPETIGLQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.65
3 0.64
4 0.65
5 0.66
6 0.68
7 0.66
8 0.65
9 0.64
10 0.61
11 0.62
12 0.63
13 0.63
14 0.64
15 0.72
16 0.77
17 0.84
18 0.88
19 0.87
20 0.87
21 0.83
22 0.82
23 0.76
24 0.69
25 0.62
26 0.55
27 0.46
28 0.35
29 0.28
30 0.18
31 0.14
32 0.1
33 0.08
34 0.06
35 0.05
36 0.05
37 0.04
38 0.05
39 0.05
40 0.06
41 0.06
42 0.06
43 0.1
44 0.15
45 0.17
46 0.17
47 0.2
48 0.28
49 0.36
50 0.39
51 0.42
52 0.48
53 0.53
54 0.62
55 0.62
56 0.64
57 0.61
58 0.59
59 0.54
60 0.47
61 0.49
62 0.47
63 0.45
64 0.39
65 0.38
66 0.37
67 0.36
68 0.34
69 0.26
70 0.2
71 0.22
72 0.21
73 0.23
74 0.23
75 0.21
76 0.2
77 0.19
78 0.19
79 0.16
80 0.15
81 0.11
82 0.12
83 0.15
84 0.16
85 0.17
86 0.18
87 0.18
88 0.17