Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7S8W9

Protein Details
Accession M7S8W9    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
101-122DTPPPAKKPRTKRDKAEHHFWABasic
128-147HVYCRKCYENRKPTVRNPVHHydrophilic
NLS Segment(s)
PositionSequence
107-113KKPRTKR
Subcellular Location(s) cyto 14.5, cyto_nucl 12, nucl 8.5, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR038886  E3_SLX5/Rfp1  
IPR017907  Znf_RING_CS  
Gene Ontology GO:0046872  F:metal ion binding  
KEGG ela:UCREL1_10493  -  
PROSITE View protein in PROSITE  
PS00518  ZF_RING_1  
Amino Acid Sequences MFGFLNNAAALGERPAGGGGGEELAFIGERPLPINIGMRLDYGHNAFRAHQDPGVPARPAHEPPKAAREGFTRETGEDVIAICPSCDQELAYDPDGDAYGDTPPPAKKPRTKRDKAEHHFWAVKACGHVYCRKCYENRKPTVRNPVHVGFRPDPKGNKGKILCAVDDCESDVSNKTAWVGIFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.07
5 0.07
6 0.06
7 0.06
8 0.06
9 0.06
10 0.06
11 0.06
12 0.06
13 0.05
14 0.06
15 0.06
16 0.07
17 0.08
18 0.09
19 0.1
20 0.11
21 0.14
22 0.14
23 0.15
24 0.16
25 0.15
26 0.15
27 0.15
28 0.16
29 0.15
30 0.16
31 0.14
32 0.15
33 0.15
34 0.19
35 0.21
36 0.21
37 0.19
38 0.18
39 0.2
40 0.24
41 0.27
42 0.23
43 0.2
44 0.21
45 0.23
46 0.26
47 0.28
48 0.27
49 0.26
50 0.27
51 0.34
52 0.35
53 0.31
54 0.3
55 0.28
56 0.31
57 0.31
58 0.32
59 0.25
60 0.23
61 0.24
62 0.22
63 0.19
64 0.12
65 0.1
66 0.08
67 0.07
68 0.07
69 0.05
70 0.05
71 0.05
72 0.05
73 0.05
74 0.04
75 0.05
76 0.08
77 0.11
78 0.11
79 0.11
80 0.11
81 0.11
82 0.11
83 0.1
84 0.07
85 0.05
86 0.05
87 0.05
88 0.05
89 0.07
90 0.07
91 0.12
92 0.17
93 0.23
94 0.3
95 0.41
96 0.51
97 0.61
98 0.68
99 0.73
100 0.78
101 0.84
102 0.83
103 0.81
104 0.74
105 0.69
106 0.65
107 0.55
108 0.48
109 0.38
110 0.33
111 0.25
112 0.22
113 0.18
114 0.18
115 0.25
116 0.25
117 0.3
118 0.33
119 0.36
120 0.42
121 0.5
122 0.58
123 0.61
124 0.67
125 0.71
126 0.73
127 0.77
128 0.82
129 0.76
130 0.7
131 0.67
132 0.63
133 0.6
134 0.57
135 0.57
136 0.51
137 0.53
138 0.54
139 0.53
140 0.51
141 0.51
142 0.56
143 0.51
144 0.56
145 0.5
146 0.5
147 0.52
148 0.52
149 0.46
150 0.39
151 0.4
152 0.33
153 0.32
154 0.28
155 0.21
156 0.18
157 0.18
158 0.18
159 0.16
160 0.15
161 0.14
162 0.13
163 0.15