Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7SY16

Protein Details
Accession M7SY16    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
39-59NNNNKDGKKKDDKSNKKDDKSBasic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 14, cyto 4.5
Family & Domain DBs
KEGG ela:UCREL1_10590  -  
Amino Acid Sequences MSSSGNSYPASNSGNKDNSDAASTFSASSTTALLKNNNNNNNKDGKKKDDKSNKKDDKSSSDSSSQIMRQAFRGQLVNHT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.31
3 0.32
4 0.3
5 0.28
6 0.27
7 0.25
8 0.2
9 0.16
10 0.16
11 0.14
12 0.13
13 0.12
14 0.09
15 0.1
16 0.08
17 0.08
18 0.1
19 0.11
20 0.14
21 0.17
22 0.24
23 0.31
24 0.37
25 0.4
26 0.4
27 0.42
28 0.46
29 0.45
30 0.46
31 0.42
32 0.43
33 0.49
34 0.53
35 0.61
36 0.64
37 0.73
38 0.73
39 0.81
40 0.82
41 0.77
42 0.77
43 0.72
44 0.7
45 0.66
46 0.63
47 0.56
48 0.5
49 0.45
50 0.41
51 0.4
52 0.32
53 0.3
54 0.28
55 0.24
56 0.24
57 0.29
58 0.29
59 0.28
60 0.32