Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4RLK7

Protein Details
Accession F4RLK7   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
191-210SQSKMFYKTAKKQNSCCIISHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 6, cyto_nucl 6, cyto 4, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR011012  Longin-like_dom_sf  
IPR010908  Longin_dom  
IPR045848  R-SNARE_YKT6  
IPR001388  Synaptobrevin-like  
IPR042855  V_SNARE_CC  
Gene Ontology GO:0012505  C:endomembrane system  
GO:0005886  C:plasma membrane  
GO:0016192  P:vesicle-mediated transport  
KEGG mlr:MELLADRAFT_116460  -  
Pfam View protein in Pfam  
PF13774  Longin  
PF00957  Synaptobrevin  
PROSITE View protein in PROSITE  
PS50859  LONGIN  
PS50892  V_SNARE  
CDD cd14824  Longin  
cd15867  R-SNARE_YKT6  
Amino Acid Sequences MKVLSIQILVIEQPNKPPAVPVAQASDLSSFSFLQRGSIGEFLNFLSKTVAERTSSGQRQSVQENNYTAHAYLRPVDNLIAVIITDDEYPIRAAFSLLNKLLDEFTTKFTQSQWKAALANPTGGVAASGIKFPTIDEYLVKYQDPKQADTIMKVQQELDETKIILHKTIESVLERGESLDRLVDRSNALSSQSKMFYKTAKKQNSCCIIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.21
4 0.22
5 0.21
6 0.25
7 0.26
8 0.23
9 0.26
10 0.26
11 0.27
12 0.26
13 0.24
14 0.19
15 0.18
16 0.17
17 0.12
18 0.11
19 0.14
20 0.12
21 0.12
22 0.12
23 0.13
24 0.13
25 0.16
26 0.15
27 0.13
28 0.14
29 0.13
30 0.16
31 0.15
32 0.13
33 0.12
34 0.12
35 0.13
36 0.16
37 0.17
38 0.14
39 0.16
40 0.2
41 0.28
42 0.31
43 0.32
44 0.32
45 0.33
46 0.34
47 0.38
48 0.39
49 0.32
50 0.32
51 0.32
52 0.29
53 0.28
54 0.26
55 0.21
56 0.17
57 0.16
58 0.13
59 0.13
60 0.14
61 0.13
62 0.13
63 0.13
64 0.11
65 0.1
66 0.09
67 0.07
68 0.05
69 0.04
70 0.04
71 0.04
72 0.04
73 0.04
74 0.04
75 0.04
76 0.05
77 0.05
78 0.05
79 0.04
80 0.05
81 0.06
82 0.08
83 0.11
84 0.11
85 0.12
86 0.12
87 0.12
88 0.12
89 0.11
90 0.12
91 0.09
92 0.12
93 0.13
94 0.13
95 0.13
96 0.14
97 0.22
98 0.21
99 0.24
100 0.23
101 0.23
102 0.24
103 0.25
104 0.29
105 0.22
106 0.21
107 0.17
108 0.15
109 0.13
110 0.12
111 0.1
112 0.05
113 0.06
114 0.05
115 0.05
116 0.05
117 0.05
118 0.05
119 0.05
120 0.09
121 0.09
122 0.09
123 0.1
124 0.14
125 0.16
126 0.17
127 0.18
128 0.16
129 0.2
130 0.24
131 0.26
132 0.24
133 0.24
134 0.29
135 0.3
136 0.31
137 0.31
138 0.3
139 0.29
140 0.27
141 0.25
142 0.2
143 0.23
144 0.21
145 0.19
146 0.15
147 0.15
148 0.15
149 0.18
150 0.17
151 0.16
152 0.15
153 0.13
154 0.14
155 0.16
156 0.17
157 0.16
158 0.16
159 0.16
160 0.16
161 0.15
162 0.14
163 0.14
164 0.12
165 0.11
166 0.14
167 0.13
168 0.15
169 0.16
170 0.16
171 0.16
172 0.18
173 0.19
174 0.16
175 0.2
176 0.22
177 0.22
178 0.26
179 0.29
180 0.28
181 0.3
182 0.32
183 0.36
184 0.42
185 0.5
186 0.55
187 0.62
188 0.68
189 0.71
190 0.79