Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7TL10

Protein Details
Accession M7TL10    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
192-211AKEIEAKLQREKEKKKEAEKBasic
NLS Segment(s)
PositionSequence
201-211REKEKKKEAEK
Subcellular Location(s) mito 11, cyto 7.5, cyto_nucl 6.5, nucl 4.5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR011990  TPR-like_helical_dom_sf  
IPR019734  TPR_repeat  
KEGG ela:UCREL1_5555  -  
Amino Acid Sequences MASDLDTYTHLPLHFDGQTKAISAPTSKSRTLAAELEALNALHRSLLTVEGASGVPPPPLPVNPKRSANITKLRESGNGEVRKGRPAEAVKLYGLGLQMALGRPLWEPQGLVREEVAALYANRAQARMALQRWADAAVDAEASVEAKRVGNGKAWWRRGRCLLEMGRLDEAKEWVGRGLELEGDEGELAALAKEIEAKLQREKEKKKEAEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.22
4 0.21
5 0.22
6 0.22
7 0.21
8 0.18
9 0.16
10 0.16
11 0.19
12 0.25
13 0.3
14 0.29
15 0.29
16 0.3
17 0.31
18 0.33
19 0.31
20 0.24
21 0.24
22 0.23
23 0.23
24 0.21
25 0.19
26 0.15
27 0.13
28 0.11
29 0.07
30 0.07
31 0.06
32 0.06
33 0.08
34 0.08
35 0.07
36 0.07
37 0.09
38 0.09
39 0.08
40 0.08
41 0.07
42 0.07
43 0.07
44 0.09
45 0.09
46 0.12
47 0.19
48 0.25
49 0.33
50 0.38
51 0.42
52 0.42
53 0.47
54 0.49
55 0.5
56 0.52
57 0.48
58 0.47
59 0.46
60 0.46
61 0.42
62 0.41
63 0.39
64 0.38
65 0.36
66 0.32
67 0.35
68 0.34
69 0.36
70 0.33
71 0.28
72 0.25
73 0.25
74 0.29
75 0.26
76 0.27
77 0.23
78 0.23
79 0.22
80 0.17
81 0.15
82 0.1
83 0.07
84 0.05
85 0.06
86 0.05
87 0.05
88 0.04
89 0.05
90 0.05
91 0.06
92 0.07
93 0.06
94 0.06
95 0.07
96 0.13
97 0.12
98 0.13
99 0.12
100 0.11
101 0.11
102 0.11
103 0.1
104 0.05
105 0.05
106 0.06
107 0.07
108 0.08
109 0.09
110 0.09
111 0.08
112 0.09
113 0.12
114 0.16
115 0.16
116 0.18
117 0.18
118 0.19
119 0.19
120 0.18
121 0.15
122 0.1
123 0.1
124 0.06
125 0.06
126 0.06
127 0.05
128 0.04
129 0.05
130 0.05
131 0.05
132 0.05
133 0.05
134 0.07
135 0.09
136 0.11
137 0.15
138 0.19
139 0.28
140 0.36
141 0.44
142 0.5
143 0.51
144 0.54
145 0.58
146 0.59
147 0.52
148 0.51
149 0.47
150 0.47
151 0.47
152 0.45
153 0.4
154 0.36
155 0.33
156 0.27
157 0.24
158 0.18
159 0.16
160 0.14
161 0.12
162 0.13
163 0.12
164 0.11
165 0.11
166 0.1
167 0.1
168 0.1
169 0.09
170 0.09
171 0.08
172 0.07
173 0.06
174 0.05
175 0.05
176 0.04
177 0.04
178 0.04
179 0.04
180 0.06
181 0.07
182 0.12
183 0.17
184 0.2
185 0.28
186 0.37
187 0.46
188 0.54
189 0.63
190 0.68
191 0.74