Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7SXS9

Protein Details
Accession M7SXS9   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
307-328SEEGRLKKRLKRQQGDEKKDGEBasic
NLS Segment(s)
PositionSequence
311-318RLKKRLKR
386-386K
Subcellular Location(s) cyto 12.5cyto_nucl 12.5, nucl 9.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007900  TAF4_C  
Gene Ontology GO:0005669  C:transcription factor TFIID complex  
GO:0006352  P:DNA-templated transcription initiation  
KEGG ela:UCREL1_10695  -  
Pfam View protein in Pfam  
PF05236  TAF4  
Amino Acid Sequences MGPPSVAPSAFAANDAQKQASKGAPSKGSDYDMNDMLAGTGINLDEEAEKLNDFEIREGFPYHPPGGKDSFYGAGPANQPSQHTDVPSQEEMVAEVADEAWNEAARRLTVFRTNELLNNFLEPGVVHRRLVNRASKHGLSLNTELKPDGKSQYMGRISSPADFPKPEIKVSFKKADNGMMVHTHGSFIPHEAYLIDQIAFLSIATKEHMRSLIGEANRVATTRQRTAHGAVPLEWADAAAPQQPNTDGLRAGSPRTGAESAVSPRTNPLKRPADEISNGLPTPVSEASPPNLLAEALEGVGKAVRNSEEGRLKKRLKRQQGDEKKDGEDGSSRAGSVAPGTPGSIAPEGEAKPMTKKESKKAAKLAEISSTTVNQTLSMFAGGKKKKKYSWMNGGGMGSGASTPRGGPQGPGLPGTPGGPAGGAGNRAARGPLTRDSAHRLGAFREDSEKGKNIQLRDWVAVLEDRDVDPIVLQTAYNKLDKSDFGDKVVRMDVSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.25
3 0.25
4 0.23
5 0.25
6 0.27
7 0.28
8 0.31
9 0.32
10 0.37
11 0.41
12 0.42
13 0.45
14 0.45
15 0.45
16 0.42
17 0.4
18 0.37
19 0.33
20 0.3
21 0.26
22 0.22
23 0.18
24 0.15
25 0.11
26 0.06
27 0.06
28 0.05
29 0.05
30 0.05
31 0.06
32 0.06
33 0.07
34 0.09
35 0.09
36 0.09
37 0.09
38 0.1
39 0.12
40 0.12
41 0.14
42 0.14
43 0.15
44 0.17
45 0.19
46 0.2
47 0.22
48 0.27
49 0.27
50 0.29
51 0.28
52 0.31
53 0.33
54 0.32
55 0.29
56 0.27
57 0.25
58 0.22
59 0.23
60 0.19
61 0.19
62 0.2
63 0.21
64 0.22
65 0.21
66 0.22
67 0.24
68 0.29
69 0.27
70 0.27
71 0.28
72 0.28
73 0.33
74 0.33
75 0.3
76 0.25
77 0.23
78 0.2
79 0.18
80 0.14
81 0.08
82 0.07
83 0.06
84 0.06
85 0.06
86 0.05
87 0.05
88 0.06
89 0.07
90 0.08
91 0.09
92 0.09
93 0.11
94 0.13
95 0.15
96 0.22
97 0.24
98 0.25
99 0.28
100 0.29
101 0.31
102 0.31
103 0.29
104 0.22
105 0.21
106 0.19
107 0.15
108 0.14
109 0.1
110 0.13
111 0.19
112 0.2
113 0.19
114 0.22
115 0.26
116 0.31
117 0.37
118 0.4
119 0.36
120 0.41
121 0.47
122 0.44
123 0.42
124 0.42
125 0.38
126 0.34
127 0.36
128 0.35
129 0.3
130 0.3
131 0.28
132 0.26
133 0.25
134 0.23
135 0.2
136 0.17
137 0.18
138 0.19
139 0.27
140 0.29
141 0.28
142 0.26
143 0.27
144 0.26
145 0.26
146 0.27
147 0.21
148 0.2
149 0.2
150 0.22
151 0.25
152 0.26
153 0.26
154 0.26
155 0.3
156 0.34
157 0.39
158 0.45
159 0.39
160 0.42
161 0.42
162 0.43
163 0.39
164 0.33
165 0.28
166 0.22
167 0.21
168 0.17
169 0.16
170 0.12
171 0.1
172 0.11
173 0.09
174 0.09
175 0.1
176 0.09
177 0.09
178 0.08
179 0.09
180 0.08
181 0.09
182 0.07
183 0.06
184 0.06
185 0.06
186 0.06
187 0.05
188 0.05
189 0.04
190 0.05
191 0.06
192 0.07
193 0.07
194 0.09
195 0.1
196 0.09
197 0.1
198 0.12
199 0.16
200 0.16
201 0.16
202 0.15
203 0.16
204 0.16
205 0.15
206 0.13
207 0.12
208 0.16
209 0.2
210 0.21
211 0.22
212 0.24
213 0.26
214 0.3
215 0.28
216 0.25
217 0.21
218 0.21
219 0.19
220 0.17
221 0.14
222 0.09
223 0.07
224 0.06
225 0.06
226 0.08
227 0.08
228 0.08
229 0.09
230 0.09
231 0.11
232 0.12
233 0.13
234 0.09
235 0.09
236 0.12
237 0.12
238 0.12
239 0.11
240 0.1
241 0.1
242 0.12
243 0.12
244 0.09
245 0.09
246 0.11
247 0.12
248 0.16
249 0.16
250 0.13
251 0.16
252 0.24
253 0.25
254 0.25
255 0.32
256 0.36
257 0.37
258 0.42
259 0.41
260 0.38
261 0.38
262 0.38
263 0.31
264 0.25
265 0.24
266 0.19
267 0.16
268 0.11
269 0.13
270 0.12
271 0.1
272 0.08
273 0.1
274 0.11
275 0.13
276 0.13
277 0.1
278 0.1
279 0.09
280 0.08
281 0.07
282 0.06
283 0.05
284 0.05
285 0.04
286 0.04
287 0.05
288 0.06
289 0.05
290 0.06
291 0.06
292 0.09
293 0.1
294 0.16
295 0.23
296 0.27
297 0.33
298 0.41
299 0.47
300 0.51
301 0.6
302 0.64
303 0.67
304 0.72
305 0.76
306 0.78
307 0.83
308 0.85
309 0.81
310 0.74
311 0.64
312 0.58
313 0.48
314 0.38
315 0.3
316 0.22
317 0.19
318 0.16
319 0.15
320 0.13
321 0.13
322 0.12
323 0.1
324 0.11
325 0.08
326 0.08
327 0.09
328 0.09
329 0.09
330 0.11
331 0.11
332 0.09
333 0.09
334 0.12
335 0.13
336 0.14
337 0.15
338 0.13
339 0.16
340 0.2
341 0.25
342 0.28
343 0.33
344 0.4
345 0.5
346 0.56
347 0.59
348 0.64
349 0.64
350 0.63
351 0.62
352 0.55
353 0.5
354 0.45
355 0.39
356 0.32
357 0.27
358 0.22
359 0.2
360 0.18
361 0.13
362 0.11
363 0.11
364 0.1
365 0.1
366 0.1
367 0.12
368 0.21
369 0.26
370 0.33
371 0.39
372 0.45
373 0.48
374 0.57
375 0.65
376 0.66
377 0.71
378 0.74
379 0.7
380 0.67
381 0.63
382 0.53
383 0.42
384 0.32
385 0.21
386 0.12
387 0.09
388 0.06
389 0.06
390 0.06
391 0.08
392 0.11
393 0.11
394 0.12
395 0.17
396 0.23
397 0.24
398 0.25
399 0.23
400 0.22
401 0.22
402 0.22
403 0.17
404 0.11
405 0.1
406 0.08
407 0.08
408 0.08
409 0.09
410 0.1
411 0.1
412 0.12
413 0.12
414 0.13
415 0.13
416 0.12
417 0.14
418 0.17
419 0.21
420 0.25
421 0.27
422 0.3
423 0.37
424 0.39
425 0.4
426 0.39
427 0.35
428 0.32
429 0.36
430 0.34
431 0.28
432 0.3
433 0.29
434 0.29
435 0.33
436 0.35
437 0.31
438 0.36
439 0.39
440 0.36
441 0.39
442 0.43
443 0.42
444 0.4
445 0.38
446 0.31
447 0.29
448 0.29
449 0.25
450 0.2
451 0.17
452 0.15
453 0.16
454 0.17
455 0.15
456 0.12
457 0.12
458 0.12
459 0.1
460 0.1
461 0.1
462 0.15
463 0.19
464 0.21
465 0.21
466 0.21
467 0.24
468 0.25
469 0.31
470 0.34
471 0.33
472 0.35
473 0.41
474 0.39
475 0.4
476 0.42