FuNGI

M7SXS9

Protein Details

Accession

M7SXS9

Localization Confidence

Medium

Confidence Score

12.4

NoLS Segment(s)

Position	Sequence	Protein Nature
307-328	SEEGRLKKRLKRQQGDEKKDGE	Basic

NLS Segment(s)

Position	Sequence
311-318	RLKKRLKR
386-386	K

Subcellular Location(s)

cyto 12.5, cyto_nucl 12.5, nucl 9.5, mito 5

Family & Domain DBs

InterPro	View protein in InterPro IPR007900 TAF4_C
Gene Ontology	GO:0005669 C:transcription factor TFIID complex GO:0006352 P:DNA-templated transcription initiation
KEGG	ela:UCREL1_10695 -
Pfam	View protein in Pfam PF05236 TAF4

Amino Acid Sequences

MGPPSVAPSAFAANDAQKQASKGAPSKGSDYDMNDMLAGTGINLDEEAEKLNDFEIREGFPYHPPGGKDSFYGAGPANQPSQHTDVPSQEEMVAEVADEAWNEAARRLTVFRTNELLNNFLEPGVVHRRLVNRASKHGLSLNTELKPDGKSQYMGRISSPADFPKPEIKVSFKKADNGMMVHTHGSFIPHEAYLIDQIAFLSIATKEHMRSLIGEANRVATTRQRTAHGAVPLEWADAAAPQQPNTDGLRAGSPRTGAESAVSPRTNPLKRPADEISNGLPTPVSEASPPNLLAEALEGVGKAVRNSEEGRLKKRLKRQQGDEKKDGEDGSSRAGSVAPGTPGSIAPEGEAKPMTKKESKKAAKLAEISSTTVNQTLSMFAGGKKKKKYSWMNGGGMGSGASTPRGGPQGPGLPGTPGGPAGGAGNRAARGPLTRDSAHRLGAFREDSEKGKNIQLRDWVAVLEDRDVDPIVLQTAYNKLDKSDFGDKVVRMDVSA

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.24
2	0.25
3	0.25
4	0.23
5	0.25
6	0.27
7	0.28
8	0.31
9	0.32
10	0.37
11	0.41
12	0.42
13	0.45
14	0.45
15	0.45
16	0.42
17	0.4
18	0.37
19	0.33
20	0.3
21	0.26
22	0.22
23	0.18
24	0.15
25	0.11
26	0.06
27	0.06
28	0.05
29	0.05
30	0.05
31	0.06
32	0.06
33	0.07
34	0.09
35	0.09
36	0.09
37	0.09
38	0.1
39	0.12
40	0.12
41	0.14
42	0.14
43	0.15
44	0.17
45	0.19
46	0.2
47	0.22
48	0.27
49	0.27
50	0.29
51	0.28
52	0.31
53	0.33
54	0.32
55	0.29
56	0.27
57	0.25
58	0.22
59	0.23
60	0.19
61	0.19
62	0.2
63	0.21
64	0.22
65	0.21
66	0.22
67	0.24
68	0.29
69	0.27
70	0.27
71	0.28
72	0.28
73	0.33
74	0.33
75	0.3
76	0.25
77	0.23
78	0.2
79	0.18
80	0.14
81	0.08
82	0.07
83	0.06
84	0.06
85	0.06
86	0.05
87	0.05
88	0.06
89	0.07
90	0.08
91	0.09
92	0.09
93	0.11
94	0.13
95	0.15
96	0.22
97	0.24
98	0.25
99	0.28
100	0.29
101	0.31
102	0.31
103	0.29
104	0.22
105	0.21
106	0.19
107	0.15
108	0.14
109	0.1
110	0.13
111	0.19
112	0.2
113	0.19
114	0.22
115	0.26
116	0.31
117	0.37
118	0.4
119	0.36
120	0.41
121	0.47
122	0.44
123	0.42
124	0.42
125	0.38
126	0.34
127	0.36
128	0.35
129	0.3
130	0.3
131	0.28
132	0.26
133	0.25
134	0.23
135	0.2
136	0.17
137	0.18
138	0.19
139	0.27
140	0.29
141	0.28
142	0.26
143	0.27
144	0.26
145	0.26
146	0.27
147	0.21
148	0.2
149	0.2
150	0.22
151	0.25
152	0.26
153	0.26
154	0.26
155	0.3
156	0.34
157	0.39
158	0.45
159	0.39
160	0.42
161	0.42
162	0.43
163	0.39
164	0.33
165	0.28
166	0.22
167	0.21
168	0.17
169	0.16
170	0.12
171	0.1
172	0.11
173	0.09
174	0.09
175	0.1
176	0.09
177	0.09
178	0.08
179	0.09
180	0.08
181	0.09
182	0.07
183	0.06
184	0.06
185	0.06
186	0.06
187	0.05
188	0.05
189	0.04
190	0.05
191	0.06
192	0.07
193	0.07
194	0.09
195	0.1
196	0.09
197	0.1
198	0.12
199	0.16
200	0.16
201	0.16
202	0.15
203	0.16
204	0.16
205	0.15
206	0.13
207	0.12
208	0.16
209	0.2
210	0.21
211	0.22
212	0.24
213	0.26
214	0.3
215	0.28
216	0.25
217	0.21
218	0.21
219	0.19
220	0.17
221	0.14
222	0.09
223	0.07
224	0.06
225	0.06
226	0.08
227	0.08
228	0.08
229	0.09
230	0.09
231	0.11
232	0.12
233	0.13
234	0.09
235	0.09
236	0.12
237	0.12
238	0.12
239	0.11
240	0.1
241	0.1
242	0.12
243	0.12
244	0.09
245	0.09
246	0.11
247	0.12
248	0.16
249	0.16
250	0.13
251	0.16
252	0.24
253	0.25
254	0.25
255	0.32
256	0.36
257	0.37
258	0.42
259	0.41
260	0.38
261	0.38
262	0.38
263	0.31
264	0.25
265	0.24
266	0.19
267	0.16
268	0.11
269	0.13
270	0.12
271	0.1
272	0.08
273	0.1
274	0.11
275	0.13
276	0.13
277	0.1
278	0.1
279	0.09
280	0.08
281	0.07
282	0.06
283	0.05
284	0.05
285	0.04
286	0.04
287	0.05
288	0.06
289	0.05
290	0.06
291	0.06
292	0.09
293	0.1
294	0.16
295	0.23
296	0.27
297	0.33
298	0.41
299	0.47
300	0.51
301	0.6
302	0.64
303	0.67
304	0.72
305	0.76
306	0.78
307	0.83
308	0.85
309	0.81
310	0.74
311	0.64
312	0.58
313	0.48
314	0.38
315	0.3
316	0.22
317	0.19
318	0.16
319	0.15
320	0.13
321	0.13
322	0.12
323	0.1
324	0.11
325	0.08
326	0.08
327	0.09
328	0.09
329	0.09
330	0.11
331	0.11
332	0.09
333	0.09
334	0.12
335	0.13
336	0.14
337	0.15
338	0.13
339	0.16
340	0.2
341	0.25
342	0.28
343	0.33
344	0.4
345	0.5
346	0.56
347	0.59
348	0.64
349	0.64
350	0.63
351	0.62
352	0.55
353	0.5
354	0.45
355	0.39
356	0.32
357	0.27
358	0.22
359	0.2
360	0.18
361	0.13
362	0.11
363	0.11
364	0.1
365	0.1
366	0.1
367	0.12
368	0.21
369	0.26
370	0.33
371	0.39
372	0.45
373	0.48
374	0.57
375	0.65
376	0.66
377	0.71
378	0.74
379	0.7
380	0.67
381	0.63
382	0.53
383	0.42
384	0.32
385	0.21
386	0.12
387	0.09
388	0.06
389	0.06
390	0.06
391	0.08
392	0.11
393	0.11
394	0.12
395	0.17
396	0.23
397	0.24
398	0.25
399	0.23
400	0.22
401	0.22
402	0.22
403	0.17
404	0.11
405	0.1
406	0.08
407	0.08
408	0.08
409	0.09
410	0.1
411	0.1
412	0.12
413	0.12
414	0.13
415	0.13
416	0.12
417	0.14
418	0.17
419	0.21
420	0.25
421	0.27
422	0.3
423	0.37
424	0.39
425	0.4
426	0.39
427	0.35
428	0.32
429	0.36
430	0.34
431	0.28
432	0.3
433	0.29
434	0.29
435	0.33
436	0.35
437	0.31
438	0.36
439	0.39
440	0.36
441	0.39
442	0.43
443	0.42
444	0.4
445	0.38
446	0.31
447	0.29
448	0.29
449	0.25
450	0.2
451	0.17
452	0.15
453	0.16
454	0.17
455	0.15
456	0.12
457	0.12
458	0.12
459	0.1
460	0.1
461	0.1
462	0.15
463	0.19
464	0.21
465	0.21
466	0.21
467	0.24
468	0.25
469	0.31
470	0.34
471	0.33
472	0.35
473	0.41
474	0.39
475	0.4
476	0.42

M7SXS9

3D AlphaFold-predicted Structure Viewer