Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7S8M5

Protein Details
Accession M7S8M5   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
109-130SNRMSSRSKYGTKKPKKASVGAHydrophilic
NLS Segment(s)
PositionSequence
121-125KKPKK
Subcellular Location(s) mito 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR006032  Ribosomal_S12/S23  
IPR005679  Ribosomal_S12_bac  
Gene Ontology GO:0015935  C:small ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG ela:UCREL1_10585  -  
Pfam View protein in Pfam  
PF00164  Ribosom_S12_S23  
CDD cd03368  Ribosomal_S12  
Amino Acid Sequences MAVPGTKGCRKAQRARHAVSPALSDTLCPQQKGVCLKVGITRPKKPNSGERKTARVRLSSGRMITAYIPGEGHNIQQHSVVLVRGGRSQDCPGVRYHLVRGALDLGGVSNRMSSRSKYGTKKPKKASVGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.74
3 0.76
4 0.7
5 0.65
6 0.56
7 0.49
8 0.39
9 0.33
10 0.28
11 0.2
12 0.19
13 0.25
14 0.26
15 0.23
16 0.22
17 0.22
18 0.27
19 0.32
20 0.31
21 0.26
22 0.24
23 0.25
24 0.3
25 0.35
26 0.4
27 0.41
28 0.47
29 0.5
30 0.55
31 0.59
32 0.57
33 0.6
34 0.61
35 0.63
36 0.64
37 0.61
38 0.64
39 0.63
40 0.66
41 0.59
42 0.5
43 0.46
44 0.41
45 0.42
46 0.37
47 0.33
48 0.27
49 0.24
50 0.22
51 0.2
52 0.16
53 0.12
54 0.09
55 0.08
56 0.08
57 0.09
58 0.09
59 0.1
60 0.1
61 0.1
62 0.11
63 0.11
64 0.11
65 0.1
66 0.1
67 0.09
68 0.08
69 0.08
70 0.09
71 0.11
72 0.12
73 0.12
74 0.14
75 0.16
76 0.2
77 0.2
78 0.2
79 0.19
80 0.24
81 0.25
82 0.24
83 0.24
84 0.24
85 0.25
86 0.24
87 0.24
88 0.2
89 0.18
90 0.16
91 0.13
92 0.09
93 0.08
94 0.08
95 0.07
96 0.07
97 0.08
98 0.11
99 0.14
100 0.16
101 0.23
102 0.3
103 0.39
104 0.45
105 0.55
106 0.64
107 0.72
108 0.8
109 0.82
110 0.84