Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7SUX3

Protein Details
Accession M7SUX3   
Localization Confidence High
Confidence Score 16.9
NoLS Segment(s)
PositionSequenceProtein Nature
88-120LEQKEKKRVKELEKKVLEKKPVKKKPRKNQEYTBasic
NLS Segment(s)
PositionSequence
91-115KEKKRVKELEKKVLEKKPVKKKPRK
Subcellular Location(s) nucl 24, cyto 1.5, cyto_pero 1.5
Family & Domain DBs
KEGG ela:UCREL1_2617  -  
Amino Acid Sequences MDDRPKYENPPFVLDPEERKGTCSDGWNPRYVGDTSLMGNRFDGYRYVDQLAMMDNRVDMVNNKLSRIETQLTEASERFGELYEAVELEQKEKKRVKELEKKVLEKKPVKKKPRKNQEYT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.39
3 0.37
4 0.39
5 0.32
6 0.33
7 0.32
8 0.31
9 0.31
10 0.31
11 0.34
12 0.38
13 0.41
14 0.42
15 0.41
16 0.39
17 0.39
18 0.34
19 0.27
20 0.19
21 0.18
22 0.15
23 0.19
24 0.2
25 0.17
26 0.16
27 0.15
28 0.13
29 0.13
30 0.13
31 0.13
32 0.14
33 0.16
34 0.17
35 0.16
36 0.16
37 0.15
38 0.16
39 0.11
40 0.1
41 0.08
42 0.06
43 0.07
44 0.07
45 0.07
46 0.05
47 0.08
48 0.14
49 0.14
50 0.14
51 0.15
52 0.15
53 0.16
54 0.19
55 0.18
56 0.13
57 0.16
58 0.17
59 0.17
60 0.18
61 0.17
62 0.14
63 0.13
64 0.12
65 0.09
66 0.08
67 0.07
68 0.06
69 0.07
70 0.06
71 0.06
72 0.06
73 0.09
74 0.09
75 0.11
76 0.16
77 0.17
78 0.25
79 0.3
80 0.34
81 0.4
82 0.48
83 0.56
84 0.63
85 0.71
86 0.73
87 0.77
88 0.8
89 0.8
90 0.79
91 0.78
92 0.76
93 0.77
94 0.77
95 0.79
96 0.84
97 0.86
98 0.9
99 0.91
100 0.94