Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7T587

Protein Details
Accession M7T587    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
63-87AWKTEWSALKRKRSRKKEYAGSATSHydrophilic
NLS Segment(s)
PositionSequence
72-79KRKRSRKK
Subcellular Location(s) nucl 14, cyto_nucl 10.5, mito 7, cyto 5
Family & Domain DBs
KEGG ela:UCREL1_11270  -  
Amino Acid Sequences MRAERAAQRIMYLEKRVQELENERNENEMEILNLQFQLKAIEVQCLSYVPKDADQDLRESISAWKTEWSALKRKRSRKKEYAGSATSGSPQSHARTIGSPGTPSRSSRPTPRTPGSAGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.34
3 0.35
4 0.32
5 0.33
6 0.35
7 0.39
8 0.43
9 0.44
10 0.41
11 0.41
12 0.4
13 0.34
14 0.27
15 0.19
16 0.12
17 0.1
18 0.1
19 0.09
20 0.1
21 0.09
22 0.08
23 0.08
24 0.08
25 0.07
26 0.1
27 0.09
28 0.12
29 0.12
30 0.12
31 0.12
32 0.12
33 0.12
34 0.1
35 0.11
36 0.09
37 0.11
38 0.11
39 0.12
40 0.16
41 0.16
42 0.17
43 0.16
44 0.16
45 0.13
46 0.13
47 0.14
48 0.12
49 0.11
50 0.1
51 0.1
52 0.1
53 0.13
54 0.16
55 0.18
56 0.27
57 0.33
58 0.43
59 0.5
60 0.6
61 0.69
62 0.75
63 0.81
64 0.81
65 0.84
66 0.83
67 0.83
68 0.82
69 0.73
70 0.65
71 0.57
72 0.47
73 0.41
74 0.33
75 0.24
76 0.18
77 0.19
78 0.19
79 0.2
80 0.21
81 0.2
82 0.19
83 0.23
84 0.26
85 0.24
86 0.24
87 0.23
88 0.28
89 0.29
90 0.3
91 0.33
92 0.35
93 0.39
94 0.47
95 0.54
96 0.57
97 0.63
98 0.66
99 0.65