Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4RCA1

Protein Details
Accession F4RCA1    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
12-31MTNDQKKKLCEKHTQCPKMKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 7, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR041188  HTH_ABP1_N  
KEGG mlr:MELLADRAFT_95147  -  
Pfam View protein in Pfam  
PF18107  HTH_ABP1_N  
Amino Acid Sequences MPQIKPLQAGIMTNDQKKKLCEKHTQCPKMKQSDLAKWAKHTFNLLKIPGQTTISDILKKKENYLGMSSAELSLRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.38
3 0.4
4 0.42
5 0.48
6 0.47
7 0.5
8 0.55
9 0.58
10 0.66
11 0.74
12 0.81
13 0.77
14 0.78
15 0.78
16 0.75
17 0.69
18 0.66
19 0.61
20 0.58
21 0.6
22 0.56
23 0.49
24 0.44
25 0.47
26 0.4
27 0.34
28 0.32
29 0.26
30 0.27
31 0.3
32 0.28
33 0.26
34 0.26
35 0.27
36 0.24
37 0.23
38 0.18
39 0.15
40 0.18
41 0.18
42 0.22
43 0.22
44 0.24
45 0.3
46 0.31
47 0.32
48 0.34
49 0.36
50 0.35
51 0.37
52 0.37
53 0.31
54 0.31
55 0.29
56 0.25