Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7TSH7

Protein Details
Accession M7TSH7    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
11-33DTEPAIKRTTKPKKAKASPTATPHydrophilic
NLS Segment(s)
PositionSequence
17-93KRTTKPKKAKASPTATPAASTTKAAKPAGVTKKTAAPKKPSAGVGAKVKAVAKKVETKVKGGEPKTKKAAAAPKPKV
Subcellular Location(s) mito 12, nucl 11, cyto 3
Family & Domain DBs
KEGG ela:UCREL1_3378  -  
Amino Acid Sequences MHKPRVFQQVDTEPAIKRTTKPKKAKASPTATPAASTTKAAKPAGVTKKTAAPKKPSAGVGAKVKAVAKKVETKVKGGEPKTKKAAAAPKPKVVAAEEAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.38
3 0.31
4 0.27
5 0.34
6 0.41
7 0.5
8 0.59
9 0.66
10 0.74
11 0.82
12 0.88
13 0.86
14 0.83
15 0.77
16 0.72
17 0.66
18 0.55
19 0.46
20 0.37
21 0.31
22 0.24
23 0.21
24 0.2
25 0.18
26 0.22
27 0.21
28 0.21
29 0.19
30 0.26
31 0.33
32 0.32
33 0.31
34 0.28
35 0.34
36 0.4
37 0.43
38 0.4
39 0.38
40 0.41
41 0.43
42 0.45
43 0.39
44 0.37
45 0.35
46 0.35
47 0.33
48 0.29
49 0.27
50 0.25
51 0.26
52 0.24
53 0.23
54 0.21
55 0.19
56 0.26
57 0.31
58 0.39
59 0.39
60 0.4
61 0.42
62 0.47
63 0.51
64 0.47
65 0.52
66 0.49
67 0.55
68 0.58
69 0.56
70 0.5
71 0.49
72 0.55
73 0.55
74 0.6
75 0.59
76 0.59
77 0.59
78 0.59
79 0.54
80 0.46