Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7TRP8

Protein Details
Accession M7TRP8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
284-305DGIPILKLENRRKKKEAPEGGGBasic
NLS Segment(s)
PositionSequence
294-298RRKKK
Subcellular Location(s) cysk 20, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013922  Cyclin_PHO80-like  
Gene Ontology GO:0016301  F:kinase activity  
GO:0019901  F:protein kinase binding  
GO:0016310  P:phosphorylation  
GO:0000079  P:regulation of cyclin-dependent protein serine/threonine kinase activity  
KEGG ela:UCREL1_326  -  
Pfam View protein in Pfam  
PF08613  Cyclin  
CDD cd20558  CYCLIN_ScPCL7-like  
Amino Acid Sequences MLSSGIEALVRMTGDIPPTPPPANPTYPHMSGMQREKAAIVRSYSEKSLARLREQAEATDKQKAQEMEAQGGILGNVRPSVESQPSSSSFSSSSSSSGAQPPSIDGVRLRHTSTPQSTSSTGGTPEPYIVIGANSQPLNMQHSAITRKFFSKAPPPITIEEYLLRIHRFCPMSTAVYLATSFYIFRLAVEERAIPVTGRNCHRLLLAGLRVAMKALEDLSYPHKKMARVGGVSEVELARLEISFCFLAGFELVVGEEALKTHWETLRTGKGFASAGGVNMPQLDGIPILKLENRRKKKEAPEGGGT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.14
4 0.17
5 0.22
6 0.23
7 0.23
8 0.27
9 0.3
10 0.35
11 0.35
12 0.38
13 0.4
14 0.41
15 0.42
16 0.4
17 0.38
18 0.39
19 0.44
20 0.44
21 0.38
22 0.36
23 0.36
24 0.36
25 0.37
26 0.33
27 0.27
28 0.25
29 0.28
30 0.31
31 0.3
32 0.31
33 0.28
34 0.29
35 0.35
36 0.35
37 0.35
38 0.38
39 0.38
40 0.4
41 0.4
42 0.39
43 0.37
44 0.39
45 0.37
46 0.4
47 0.38
48 0.32
49 0.37
50 0.34
51 0.31
52 0.31
53 0.31
54 0.26
55 0.25
56 0.24
57 0.19
58 0.18
59 0.15
60 0.11
61 0.09
62 0.06
63 0.06
64 0.07
65 0.07
66 0.09
67 0.13
68 0.15
69 0.17
70 0.18
71 0.22
72 0.24
73 0.28
74 0.26
75 0.23
76 0.2
77 0.2
78 0.2
79 0.17
80 0.16
81 0.13
82 0.14
83 0.15
84 0.18
85 0.17
86 0.16
87 0.15
88 0.15
89 0.17
90 0.16
91 0.14
92 0.12
93 0.14
94 0.19
95 0.21
96 0.22
97 0.21
98 0.23
99 0.29
100 0.31
101 0.31
102 0.28
103 0.3
104 0.29
105 0.28
106 0.27
107 0.21
108 0.19
109 0.16
110 0.15
111 0.12
112 0.11
113 0.09
114 0.08
115 0.07
116 0.06
117 0.06
118 0.05
119 0.05
120 0.08
121 0.07
122 0.07
123 0.08
124 0.08
125 0.12
126 0.11
127 0.11
128 0.1
129 0.13
130 0.18
131 0.19
132 0.2
133 0.17
134 0.18
135 0.2
136 0.2
137 0.22
138 0.26
139 0.32
140 0.34
141 0.36
142 0.37
143 0.37
144 0.38
145 0.35
146 0.27
147 0.21
148 0.18
149 0.16
150 0.15
151 0.14
152 0.11
153 0.11
154 0.15
155 0.15
156 0.14
157 0.16
158 0.17
159 0.18
160 0.18
161 0.19
162 0.13
163 0.13
164 0.13
165 0.1
166 0.08
167 0.06
168 0.06
169 0.05
170 0.07
171 0.06
172 0.06
173 0.09
174 0.09
175 0.1
176 0.11
177 0.11
178 0.1
179 0.11
180 0.11
181 0.09
182 0.11
183 0.14
184 0.18
185 0.21
186 0.25
187 0.24
188 0.25
189 0.25
190 0.24
191 0.22
192 0.21
193 0.2
194 0.17
195 0.17
196 0.17
197 0.17
198 0.15
199 0.13
200 0.08
201 0.07
202 0.06
203 0.06
204 0.05
205 0.07
206 0.14
207 0.2
208 0.21
209 0.24
210 0.27
211 0.27
212 0.31
213 0.38
214 0.38
215 0.34
216 0.34
217 0.36
218 0.33
219 0.33
220 0.3
221 0.22
222 0.15
223 0.13
224 0.12
225 0.07
226 0.06
227 0.07
228 0.05
229 0.08
230 0.08
231 0.07
232 0.07
233 0.07
234 0.08
235 0.07
236 0.07
237 0.05
238 0.05
239 0.05
240 0.05
241 0.05
242 0.04
243 0.04
244 0.04
245 0.05
246 0.06
247 0.07
248 0.11
249 0.13
250 0.15
251 0.17
252 0.24
253 0.33
254 0.34
255 0.34
256 0.31
257 0.31
258 0.3
259 0.28
260 0.25
261 0.16
262 0.15
263 0.15
264 0.15
265 0.12
266 0.12
267 0.11
268 0.07
269 0.07
270 0.07
271 0.07
272 0.07
273 0.08
274 0.08
275 0.1
276 0.14
277 0.23
278 0.33
279 0.43
280 0.53
281 0.61
282 0.67
283 0.75
284 0.81
285 0.84
286 0.84