Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7TJH7

Protein Details
Accession M7TJH7   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MGRRRKGNDRKPVPKPHWTFGBasic
NLS Segment(s)
PositionSequence
4-11RRKGNDRK
Subcellular Location(s) nucl 10.5, cyto_nucl 10.5, cyto 9.5, mito 5
Family & Domain DBs
KEGG ela:UCREL1_6116  -  
Amino Acid Sequences MGRRRKGNDRKPVPKPHWTFGQLMPNMGFNFGERDCFLRHVEKSRVRSSLKVFTRTMNRNQIDEALSILAQAGVDFVDHVGTVQHITFWDGISRNVEWSASLSGEKVFTLIVVLLRAHEEFERNLPDYFHPSRYGRTAKAIHEFAKLLKEKYADNPEIMNLYFSPLPTLDDEGSDTDVSVPIPEELTEEEIQAEPSWQNPFEYHHKDYDYMNDSRDDTEDEDEVSDDDGYPNPYRPKTKPHGASKFEKAFLPAIGVVDKKEEDDVDEEMYRLQIQSIADTCVRQGREPPLGTGHKLEVEIFQAASERIREGGPQAQAQPE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.84
3 0.78
4 0.77
5 0.7
6 0.65
7 0.6
8 0.63
9 0.53
10 0.49
11 0.44
12 0.38
13 0.34
14 0.31
15 0.24
16 0.15
17 0.18
18 0.16
19 0.18
20 0.15
21 0.18
22 0.19
23 0.21
24 0.24
25 0.26
26 0.31
27 0.36
28 0.45
29 0.5
30 0.55
31 0.58
32 0.62
33 0.58
34 0.6
35 0.58
36 0.58
37 0.57
38 0.56
39 0.51
40 0.5
41 0.57
42 0.58
43 0.6
44 0.6
45 0.56
46 0.51
47 0.51
48 0.48
49 0.4
50 0.34
51 0.27
52 0.17
53 0.15
54 0.13
55 0.12
56 0.08
57 0.06
58 0.05
59 0.04
60 0.03
61 0.03
62 0.04
63 0.04
64 0.04
65 0.04
66 0.04
67 0.04
68 0.04
69 0.05
70 0.05
71 0.06
72 0.06
73 0.08
74 0.08
75 0.08
76 0.11
77 0.11
78 0.13
79 0.15
80 0.15
81 0.14
82 0.14
83 0.14
84 0.11
85 0.12
86 0.12
87 0.1
88 0.1
89 0.09
90 0.09
91 0.1
92 0.09
93 0.07
94 0.06
95 0.05
96 0.05
97 0.05
98 0.05
99 0.05
100 0.06
101 0.06
102 0.07
103 0.07
104 0.08
105 0.08
106 0.09
107 0.09
108 0.12
109 0.14
110 0.15
111 0.15
112 0.16
113 0.16
114 0.22
115 0.24
116 0.23
117 0.24
118 0.24
119 0.25
120 0.3
121 0.32
122 0.27
123 0.3
124 0.32
125 0.31
126 0.35
127 0.36
128 0.31
129 0.29
130 0.29
131 0.23
132 0.27
133 0.25
134 0.21
135 0.2
136 0.2
137 0.19
138 0.24
139 0.3
140 0.24
141 0.23
142 0.22
143 0.2
144 0.2
145 0.19
146 0.14
147 0.07
148 0.08
149 0.08
150 0.07
151 0.08
152 0.07
153 0.08
154 0.08
155 0.1
156 0.08
157 0.08
158 0.09
159 0.09
160 0.1
161 0.09
162 0.08
163 0.07
164 0.07
165 0.06
166 0.06
167 0.05
168 0.04
169 0.05
170 0.05
171 0.05
172 0.05
173 0.09
174 0.09
175 0.09
176 0.1
177 0.1
178 0.1
179 0.09
180 0.1
181 0.06
182 0.08
183 0.1
184 0.09
185 0.1
186 0.1
187 0.15
188 0.22
189 0.29
190 0.3
191 0.31
192 0.32
193 0.33
194 0.33
195 0.35
196 0.32
197 0.26
198 0.25
199 0.23
200 0.23
201 0.22
202 0.23
203 0.18
204 0.14
205 0.15
206 0.14
207 0.12
208 0.12
209 0.11
210 0.11
211 0.1
212 0.08
213 0.06
214 0.07
215 0.07
216 0.11
217 0.11
218 0.16
219 0.2
220 0.24
221 0.3
222 0.32
223 0.41
224 0.46
225 0.54
226 0.59
227 0.65
228 0.71
229 0.71
230 0.75
231 0.75
232 0.72
233 0.64
234 0.55
235 0.47
236 0.38
237 0.32
238 0.28
239 0.19
240 0.15
241 0.15
242 0.15
243 0.13
244 0.14
245 0.14
246 0.12
247 0.13
248 0.12
249 0.12
250 0.14
251 0.15
252 0.15
253 0.16
254 0.15
255 0.14
256 0.15
257 0.13
258 0.11
259 0.1
260 0.09
261 0.09
262 0.13
263 0.14
264 0.17
265 0.17
266 0.17
267 0.19
268 0.22
269 0.23
270 0.21
271 0.25
272 0.29
273 0.36
274 0.37
275 0.38
276 0.4
277 0.43
278 0.44
279 0.41
280 0.37
281 0.31
282 0.3
283 0.28
284 0.22
285 0.21
286 0.19
287 0.16
288 0.14
289 0.13
290 0.13
291 0.14
292 0.14
293 0.12
294 0.12
295 0.13
296 0.14
297 0.16
298 0.22
299 0.24
300 0.27