FuNGI

M7SES6

Protein Details

Accession

M7SES6

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
35-55	SFGQWRRKEDRSSTKRRDLSY	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

cyto 18, mito 4, pero 3, mito_nucl 3

Family & Domain DBs

InterPro	View protein in InterPro IPR011251 Luciferase-like_dom IPR036661 Luciferase-like_sf IPR016215 NTA_MOA
Gene Ontology	GO:0004497 F:monooxygenase activity GO:0016705 F:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
KEGG	ela:UCREL1_10358 -
Pfam	View protein in Pfam PF00296 Bac_luciferase

Amino Acid Sequences

MSNSGPATGKGALQPADQRRIFINAFEMFTPNHLSFGQWRRKEDRSSTKRRDLSYWTNLAQILERGNITTLIIADTYGQHDVYKGSAEPTVRRAVQYPMGDPAVPVTAMATVTKNLGFVITTSTSYESPFVIAKRFSTLDHLTKGRFGWNIVTSFKESAAKAIGLPLVEHDRRYEIADEYVELLYKIWEGSWADDALKEDAENDIYTDYNRIRWIKHKSENFSLDAPHILDPSPQRTPFLLQAGTSSAGIKFAAKHAEAIMVSGLSPHVVAPRIKEIREQAAQHGRDPRSIKVFAVITPIIGKTEEEARAKFQEALKYSSAEAGLAFYSGNSGIDLSKFDLDTEIKPDDATVDGRVHSLVNSLKYRGDDVPAWTPRNIGKLYAIGGNGPVPVGSPKRVADILEEWVRVADVDGFNIGYVVTPGSFEDVVDLLIPELRRRGRYPTEIETGTIRERIYGPGQAQLRDDHVGSRYRYDNYPVE

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.32
2	0.35
3	0.44
4	0.42
5	0.41
6	0.39
7	0.44
8	0.41
9	0.34
10	0.33
11	0.27
12	0.28
13	0.27
14	0.27
15	0.21
16	0.23
17	0.27
18	0.21
19	0.2
20	0.18
21	0.19
22	0.26
23	0.35
24	0.44
25	0.43
26	0.5
27	0.54
28	0.61
29	0.67
30	0.69
31	0.7
32	0.7
33	0.76
34	0.8
35	0.83
36	0.83
37	0.78
38	0.73
39	0.7
40	0.69
41	0.67
42	0.64
43	0.55
44	0.51
45	0.49
46	0.44
47	0.37
48	0.29
49	0.22
50	0.18
51	0.17
52	0.15
53	0.14
54	0.14
55	0.13
56	0.11
57	0.09
58	0.08
59	0.08
60	0.08
61	0.08
62	0.08
63	0.1
64	0.11
65	0.11
66	0.1
67	0.11
68	0.11
69	0.11
70	0.12
71	0.1
72	0.11
73	0.13
74	0.15
75	0.17
76	0.21
77	0.26
78	0.25
79	0.26
80	0.27
81	0.28
82	0.33
83	0.33
84	0.3
85	0.28
86	0.28
87	0.27
88	0.25
89	0.22
90	0.16
91	0.13
92	0.11
93	0.08
94	0.07
95	0.08
96	0.09
97	0.08
98	0.08
99	0.09
100	0.1
101	0.09
102	0.08
103	0.08
104	0.07
105	0.07
106	0.11
107	0.11
108	0.11
109	0.12
110	0.15
111	0.15
112	0.15
113	0.16
114	0.11
115	0.11
116	0.13
117	0.13
118	0.14
119	0.15
120	0.15
121	0.18
122	0.19
123	0.18
124	0.22
125	0.26
126	0.27
127	0.31
128	0.32
129	0.29
130	0.3
131	0.3
132	0.28
133	0.23
134	0.2
135	0.2
136	0.21
137	0.23
138	0.22
139	0.24
140	0.22
141	0.22
142	0.22
143	0.21
144	0.17
145	0.16
146	0.17
147	0.15
148	0.13
149	0.14
150	0.13
151	0.1
152	0.1
153	0.1
154	0.15
155	0.15
156	0.16
157	0.15
158	0.16
159	0.17
160	0.19
161	0.19
162	0.13
163	0.14
164	0.14
165	0.14
166	0.14
167	0.13
168	0.11
169	0.09
170	0.08
171	0.07
172	0.07
173	0.06
174	0.04
175	0.06
176	0.07
177	0.08
178	0.09
179	0.1
180	0.1
181	0.11
182	0.12
183	0.11
184	0.1
185	0.09
186	0.07
187	0.07
188	0.08
189	0.07
190	0.06
191	0.06
192	0.06
193	0.06
194	0.09
195	0.08
196	0.09
197	0.13
198	0.14
199	0.16
200	0.23
201	0.31
202	0.37
203	0.45
204	0.5
205	0.51
206	0.57
207	0.58
208	0.53
209	0.45
210	0.38
211	0.3
212	0.25
213	0.2
214	0.14
215	0.11
216	0.09
217	0.1
218	0.11
219	0.15
220	0.17
221	0.16
222	0.17
223	0.17
224	0.19
225	0.2
226	0.21
227	0.17
228	0.14
229	0.14
230	0.14
231	0.14
232	0.12
233	0.1
234	0.07
235	0.07
236	0.07
237	0.07
238	0.06
239	0.07
240	0.1
241	0.09
242	0.1
243	0.1
244	0.11
245	0.11
246	0.11
247	0.09
248	0.06
249	0.06
250	0.05
251	0.05
252	0.03
253	0.04
254	0.03
255	0.05
256	0.07
257	0.08
258	0.1
259	0.18
260	0.21
261	0.21
262	0.24
263	0.25
264	0.28
265	0.32
266	0.31
267	0.29
268	0.35
269	0.36
270	0.36
271	0.42
272	0.37
273	0.38
274	0.39
275	0.36
276	0.33
277	0.33
278	0.3
279	0.25
280	0.25
281	0.2
282	0.23
283	0.2
284	0.15
285	0.15
286	0.15
287	0.12
288	0.11
289	0.1
290	0.07
291	0.12
292	0.16
293	0.17
294	0.17
295	0.2
296	0.21
297	0.23
298	0.25
299	0.23
300	0.25
301	0.25
302	0.29
303	0.27
304	0.27
305	0.26
306	0.24
307	0.21
308	0.15
309	0.12
310	0.09
311	0.08
312	0.07
313	0.06
314	0.04
315	0.05
316	0.05
317	0.05
318	0.04
319	0.05
320	0.05
321	0.06
322	0.07
323	0.08
324	0.09
325	0.09
326	0.09
327	0.11
328	0.13
329	0.13
330	0.17
331	0.16
332	0.15
333	0.15
334	0.14
335	0.13
336	0.13
337	0.13
338	0.11
339	0.11
340	0.12
341	0.12
342	0.13
343	0.12
344	0.11
345	0.13
346	0.14
347	0.17
348	0.19
349	0.2
350	0.22
351	0.22
352	0.26
353	0.23
354	0.24
355	0.21
356	0.23
357	0.31
358	0.34
359	0.36
360	0.33
361	0.34
362	0.32
363	0.36
364	0.32
365	0.24
366	0.21
367	0.2
368	0.22
369	0.22
370	0.2
371	0.15
372	0.15
373	0.14
374	0.12
375	0.1
376	0.08
377	0.07
378	0.11
379	0.13
380	0.15
381	0.18
382	0.18
383	0.22
384	0.23
385	0.23
386	0.23
387	0.23
388	0.27
389	0.28
390	0.27
391	0.23
392	0.23
393	0.22
394	0.17
395	0.16
396	0.14
397	0.1
398	0.11
399	0.11
400	0.11
401	0.11
402	0.11
403	0.1
404	0.05
405	0.06
406	0.06
407	0.05
408	0.05
409	0.06
410	0.09
411	0.09
412	0.09
413	0.1
414	0.1
415	0.1
416	0.1
417	0.1
418	0.07
419	0.1
420	0.11
421	0.11
422	0.18
423	0.22
424	0.26
425	0.29
426	0.37
427	0.43
428	0.5
429	0.55
430	0.55
431	0.58
432	0.54
433	0.53
434	0.47
435	0.43
436	0.37
437	0.33
438	0.26
439	0.22
440	0.22
441	0.26
442	0.26
443	0.28
444	0.26
445	0.3
446	0.34
447	0.33
448	0.34
449	0.31
450	0.32
451	0.29
452	0.28
453	0.25
454	0.25
455	0.3
456	0.3
457	0.34
458	0.35
459	0.36
460	0.38

M7SES6

3D AlphaFold-predicted Structure Viewer