Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7SH81

Protein Details
Accession M7SH81    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
210-230NGVQLRMRKGRKKRLSWTALGHydrophilic
NLS Segment(s)
PositionSequence
217-223RKGRKKR
Subcellular Location(s) mito 17, extr 6, cyto 4
Family & Domain DBs
KEGG ela:UCREL1_9547  -  
Amino Acid Sequences MHTILPYRLGLPFEIISLYLRRNLQIPTSTSTTLYDLVRTNLLKPHVDGVRVLAHNTGALDTAWVLSQLCADLPSHVLSEKLQVFTFGAAGVDMTASLGTLAPRDDLEKSQGQRLAYPAVTHFAFESDPFASIGVLPGIRQRLEGRYIGGLYSIGSGGIGTSRRRWTLDEYIDALFPGGDPRAGVLGQECTIDRKTSEIREMVALEQSINGVQLRMRKGRKKRLSWTALGAVASKTPDGGGSSRGSDDMAGAFALEEVRQRGIAIQGIRGYQNNALAAAVRGPHRLSPEEGVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.14
4 0.16
5 0.17
6 0.18
7 0.19
8 0.19
9 0.22
10 0.23
11 0.26
12 0.29
13 0.31
14 0.31
15 0.35
16 0.35
17 0.33
18 0.33
19 0.3
20 0.27
21 0.24
22 0.22
23 0.19
24 0.19
25 0.23
26 0.22
27 0.22
28 0.24
29 0.27
30 0.26
31 0.25
32 0.3
33 0.28
34 0.28
35 0.26
36 0.24
37 0.28
38 0.27
39 0.27
40 0.21
41 0.18
42 0.18
43 0.18
44 0.15
45 0.08
46 0.07
47 0.07
48 0.06
49 0.07
50 0.06
51 0.06
52 0.06
53 0.05
54 0.06
55 0.06
56 0.06
57 0.06
58 0.06
59 0.07
60 0.08
61 0.09
62 0.09
63 0.09
64 0.1
65 0.09
66 0.15
67 0.17
68 0.17
69 0.16
70 0.16
71 0.16
72 0.16
73 0.15
74 0.09
75 0.07
76 0.05
77 0.05
78 0.04
79 0.04
80 0.03
81 0.03
82 0.03
83 0.03
84 0.03
85 0.03
86 0.04
87 0.04
88 0.05
89 0.05
90 0.06
91 0.07
92 0.09
93 0.09
94 0.13
95 0.18
96 0.19
97 0.23
98 0.25
99 0.24
100 0.24
101 0.25
102 0.23
103 0.19
104 0.18
105 0.14
106 0.14
107 0.14
108 0.13
109 0.11
110 0.09
111 0.09
112 0.08
113 0.1
114 0.07
115 0.08
116 0.08
117 0.08
118 0.07
119 0.06
120 0.07
121 0.05
122 0.05
123 0.04
124 0.06
125 0.08
126 0.08
127 0.09
128 0.1
129 0.11
130 0.14
131 0.14
132 0.13
133 0.13
134 0.13
135 0.12
136 0.11
137 0.08
138 0.06
139 0.06
140 0.05
141 0.04
142 0.03
143 0.03
144 0.03
145 0.04
146 0.06
147 0.07
148 0.11
149 0.13
150 0.14
151 0.16
152 0.18
153 0.22
154 0.28
155 0.3
156 0.29
157 0.29
158 0.28
159 0.27
160 0.25
161 0.19
162 0.11
163 0.08
164 0.07
165 0.05
166 0.04
167 0.04
168 0.04
169 0.06
170 0.06
171 0.06
172 0.06
173 0.07
174 0.07
175 0.08
176 0.08
177 0.1
178 0.11
179 0.12
180 0.11
181 0.13
182 0.16
183 0.19
184 0.23
185 0.21
186 0.21
187 0.22
188 0.23
189 0.2
190 0.18
191 0.15
192 0.11
193 0.1
194 0.09
195 0.08
196 0.08
197 0.07
198 0.06
199 0.07
200 0.12
201 0.17
202 0.25
203 0.33
204 0.41
205 0.52
206 0.62
207 0.71
208 0.75
209 0.8
210 0.82
211 0.81
212 0.76
213 0.72
214 0.65
215 0.56
216 0.48
217 0.39
218 0.29
219 0.23
220 0.2
221 0.14
222 0.1
223 0.08
224 0.08
225 0.09
226 0.1
227 0.12
228 0.13
229 0.15
230 0.15
231 0.15
232 0.15
233 0.13
234 0.12
235 0.1
236 0.08
237 0.07
238 0.06
239 0.06
240 0.06
241 0.06
242 0.06
243 0.07
244 0.09
245 0.1
246 0.1
247 0.1
248 0.11
249 0.13
250 0.18
251 0.17
252 0.19
253 0.2
254 0.22
255 0.24
256 0.24
257 0.24
258 0.22
259 0.24
260 0.21
261 0.19
262 0.17
263 0.16
264 0.16
265 0.15
266 0.16
267 0.14
268 0.16
269 0.18
270 0.21
271 0.24
272 0.27
273 0.29