Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7SBF9

Protein Details
Accession M7SBF9    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
19-40RTGGKGTPRHKQKRNVARNSNDHydrophilic
NLS Segment(s)
PositionSequence
10-33KKFGNAAPARTGGKGTPRHKQKRN
Subcellular Location(s) nucl 18.5, cyto_nucl 10, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR039370  BTF3  
IPR002715  Nas_poly-pep-assoc_cplx_dom  
Gene Ontology GO:0005737  C:cytoplasm  
KEGG ela:UCREL1_11579  -  
Pfam View protein in Pfam  
PF01849  NAC  
PROSITE View protein in PROSITE  
PS51151  NAC_AB  
Amino Acid Sequences MPDVQELLKKKFGNAAPARTGGKGTPRHKQKRNVARNSNDDKKLQTTLKKLNTQPIQAIEEVNILKPGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.45
3 0.41
4 0.44
5 0.45
6 0.38
7 0.37
8 0.27
9 0.3
10 0.33
11 0.33
12 0.38
13 0.48
14 0.57
15 0.64
16 0.72
17 0.74
18 0.76
19 0.83
20 0.84
21 0.82
22 0.78
23 0.79
24 0.77
25 0.74
26 0.66
27 0.57
28 0.49
29 0.44
30 0.43
31 0.38
32 0.36
33 0.36
34 0.42
35 0.48
36 0.54
37 0.53
38 0.58
39 0.58
40 0.55
41 0.52
42 0.47
43 0.42
44 0.36
45 0.34
46 0.25
47 0.24
48 0.22
49 0.19