Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7T270

Protein Details
Accession M7T270   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
188-215FDSKWKLLRASEKPRRRRRGLLAQTIHEHydrophilic
NLS Segment(s)
PositionSequence
196-206RASEKPRRRRR
Subcellular Location(s) plas 15, nucl 3, mito 3, mito_nucl 3, cyto 2, extr 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG ela:UCREL1_2347  -  
Amino Acid Sequences MAAEDWLAHLKTAGSAMLWALGWMLNICYLVAIPLYYPLYYAFHSVLFVLSPAWYVFGTISSAAGVVVEFVVRLKLAYAAIIGILAGCVLHGTSNLIFVLLGVDSSSTAAEQKNRHGGGSSRRRRLAAGSEDEDGGGMRGDRSSIELEFWSGDTTTTSTSTTSAADSRRSTTKGQQQKEPALDYGELFDSKWKLLRASEKPRRRRRGLLAQTIHEESSESDSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.08
4 0.08
5 0.08
6 0.07
7 0.06
8 0.06
9 0.07
10 0.07
11 0.07
12 0.06
13 0.06
14 0.06
15 0.06
16 0.06
17 0.06
18 0.06
19 0.05
20 0.05
21 0.08
22 0.09
23 0.09
24 0.09
25 0.1
26 0.12
27 0.13
28 0.15
29 0.13
30 0.12
31 0.12
32 0.12
33 0.11
34 0.09
35 0.08
36 0.06
37 0.06
38 0.06
39 0.06
40 0.07
41 0.06
42 0.07
43 0.07
44 0.07
45 0.08
46 0.07
47 0.07
48 0.06
49 0.06
50 0.05
51 0.05
52 0.04
53 0.03
54 0.03
55 0.03
56 0.03
57 0.03
58 0.04
59 0.03
60 0.04
61 0.04
62 0.05
63 0.05
64 0.05
65 0.05
66 0.05
67 0.05
68 0.05
69 0.04
70 0.03
71 0.03
72 0.02
73 0.02
74 0.02
75 0.02
76 0.02
77 0.02
78 0.02
79 0.04
80 0.04
81 0.05
82 0.05
83 0.05
84 0.05
85 0.05
86 0.05
87 0.04
88 0.04
89 0.03
90 0.03
91 0.03
92 0.03
93 0.03
94 0.03
95 0.04
96 0.05
97 0.09
98 0.11
99 0.13
100 0.2
101 0.2
102 0.2
103 0.2
104 0.22
105 0.28
106 0.38
107 0.44
108 0.43
109 0.45
110 0.46
111 0.45
112 0.45
113 0.42
114 0.37
115 0.34
116 0.3
117 0.29
118 0.28
119 0.27
120 0.25
121 0.17
122 0.11
123 0.06
124 0.04
125 0.04
126 0.04
127 0.04
128 0.04
129 0.06
130 0.08
131 0.08
132 0.09
133 0.09
134 0.09
135 0.1
136 0.1
137 0.09
138 0.07
139 0.07
140 0.07
141 0.08
142 0.08
143 0.09
144 0.09
145 0.09
146 0.09
147 0.1
148 0.1
149 0.1
150 0.12
151 0.14
152 0.18
153 0.19
154 0.22
155 0.25
156 0.28
157 0.3
158 0.35
159 0.43
160 0.48
161 0.51
162 0.55
163 0.58
164 0.62
165 0.62
166 0.57
167 0.48
168 0.42
169 0.38
170 0.3
171 0.25
172 0.2
173 0.16
174 0.14
175 0.16
176 0.15
177 0.15
178 0.19
179 0.18
180 0.19
181 0.24
182 0.34
183 0.4
184 0.5
185 0.59
186 0.66
187 0.75
188 0.84
189 0.89
190 0.87
191 0.86
192 0.85
193 0.86
194 0.86
195 0.86
196 0.81
197 0.76
198 0.74
199 0.66
200 0.56
201 0.45
202 0.35
203 0.26