Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M7TSZ2

Protein Details
Accession M7TSZ2    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
86-105QRGIAGGEKKNKKKGKKGAIBasic
NLS Segment(s)
PositionSequence
87-105RGIAGGEKKNKKKGKKGAI
Subcellular Location(s) E.R. 9, cyto 7.5, cyto_nucl 5.5, extr 5, nucl 2.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
GO:0016787  F:hydrolase activity  
KEGG ela:UCREL1_3188  -  
Amino Acid Sequences MELTTGDGTLVLITSIVSLITGLMLGMYSVRGYLFVSPELADERRHNLYDPVESDESDVDEGDTVLDHAPNWANGVEADARDGLRQRGIAGGEKKNKKKGKKGAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.03
5 0.03
6 0.03
7 0.03
8 0.03
9 0.03
10 0.03
11 0.03
12 0.03
13 0.03
14 0.03
15 0.03
16 0.03
17 0.03
18 0.04
19 0.05
20 0.06
21 0.07
22 0.07
23 0.08
24 0.08
25 0.09
26 0.11
27 0.12
28 0.12
29 0.13
30 0.16
31 0.18
32 0.18
33 0.18
34 0.18
35 0.19
36 0.19
37 0.19
38 0.2
39 0.18
40 0.17
41 0.17
42 0.14
43 0.13
44 0.11
45 0.1
46 0.05
47 0.05
48 0.04
49 0.04
50 0.04
51 0.04
52 0.04
53 0.04
54 0.04
55 0.05
56 0.06
57 0.06
58 0.08
59 0.07
60 0.07
61 0.07
62 0.09
63 0.09
64 0.08
65 0.1
66 0.09
67 0.1
68 0.11
69 0.13
70 0.12
71 0.13
72 0.13
73 0.13
74 0.15
75 0.17
76 0.23
77 0.28
78 0.35
79 0.43
80 0.53
81 0.6
82 0.67
83 0.74
84 0.76
85 0.8