Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7T5I7

Protein Details
Accession M7T5I7   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
2-28APAASTGAKKQKKKWSKGKGKFTINFLHydrophilic
NLS Segment(s)
PositionSequence
9-22AKKQKKKWSKGKGK
Subcellular Location(s) nucl 13, mito 7, cyto 7, cyto_mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036388  WH-like_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG ela:UCREL1_11162  -  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAASTGAKKQKKKWSKGKGKFTINFLENDKAQHAVLLDKTTSEKLYKDVQSYRLVTVATLVDRLKINGSLARRCLKDLEEKGQIRPIVTHSKMKIYTRAVGASD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.82
3 0.83
4 0.86
5 0.91
6 0.93
7 0.91
8 0.9
9 0.84
10 0.78
11 0.74
12 0.64
13 0.57
14 0.49
15 0.43
16 0.34
17 0.31
18 0.27
19 0.2
20 0.18
21 0.16
22 0.13
23 0.11
24 0.12
25 0.12
26 0.11
27 0.1
28 0.11
29 0.12
30 0.13
31 0.12
32 0.11
33 0.12
34 0.18
35 0.2
36 0.22
37 0.24
38 0.26
39 0.29
40 0.3
41 0.28
42 0.23
43 0.21
44 0.17
45 0.15
46 0.12
47 0.09
48 0.09
49 0.09
50 0.09
51 0.09
52 0.1
53 0.1
54 0.1
55 0.11
56 0.12
57 0.16
58 0.18
59 0.22
60 0.27
61 0.27
62 0.28
63 0.29
64 0.28
65 0.34
66 0.35
67 0.37
68 0.42
69 0.43
70 0.43
71 0.47
72 0.45
73 0.36
74 0.33
75 0.31
76 0.32
77 0.34
78 0.39
79 0.35
80 0.42
81 0.47
82 0.49
83 0.51
84 0.46
85 0.48
86 0.44