Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7SZ35

Protein Details
Accession M7SZ35    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
198-223GGERRRTEVRYKKRIAERKELREQGLBasic
NLS Segment(s)
PositionSequence
195-216KIDGGERRRTEVRYKKRIAERK
Subcellular Location(s) mito 17, cyto_nucl 4, nucl 3, cyto 3, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR039603  Fyv4  
IPR019083  IGR_protein_motif  
IPR013761  SAM/pointed_sf  
Gene Ontology GO:0005739  C:mitochondrion  
KEGG ela:UCREL1_3158  -  
Pfam View protein in Pfam  
PF09597  IGR  
CDD cd09487  SAM_superfamily  
Amino Acid Sequences MTAASFSTTSSTPSASAKSSQQPDDIIPSPTPFIPDVQTFLTVIGRGLGQHASKFPSWEALFTLTSEQLQELGIEPPRTRRYLLQWRQRFRRGQFGIGGDLQHVGEDGAAELRVLETDGIGAGVGAVDPVRKSRFVVNVPPGVSPGADGQMSRVSGYKVKGAKTIVGPYALPLKNEAGARVAVTEGMWEDRRGHKIDGGERRRTEVRYKKRIAERKELREQGLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.22
4 0.25
5 0.32
6 0.37
7 0.38
8 0.37
9 0.37
10 0.36
11 0.39
12 0.36
13 0.3
14 0.26
15 0.25
16 0.25
17 0.23
18 0.24
19 0.18
20 0.17
21 0.18
22 0.18
23 0.19
24 0.18
25 0.19
26 0.17
27 0.17
28 0.16
29 0.13
30 0.12
31 0.09
32 0.08
33 0.07
34 0.08
35 0.11
36 0.11
37 0.12
38 0.14
39 0.17
40 0.17
41 0.18
42 0.17
43 0.21
44 0.21
45 0.2
46 0.2
47 0.19
48 0.19
49 0.18
50 0.2
51 0.13
52 0.13
53 0.12
54 0.1
55 0.08
56 0.08
57 0.07
58 0.07
59 0.09
60 0.11
61 0.12
62 0.13
63 0.19
64 0.22
65 0.23
66 0.24
67 0.24
68 0.31
69 0.41
70 0.5
71 0.54
72 0.59
73 0.66
74 0.72
75 0.76
76 0.74
77 0.65
78 0.67
79 0.58
80 0.53
81 0.48
82 0.42
83 0.37
84 0.31
85 0.28
86 0.18
87 0.16
88 0.12
89 0.09
90 0.07
91 0.04
92 0.04
93 0.03
94 0.03
95 0.03
96 0.03
97 0.03
98 0.03
99 0.03
100 0.03
101 0.03
102 0.03
103 0.02
104 0.02
105 0.03
106 0.03
107 0.02
108 0.02
109 0.02
110 0.02
111 0.02
112 0.02
113 0.02
114 0.02
115 0.03
116 0.05
117 0.07
118 0.08
119 0.09
120 0.13
121 0.19
122 0.22
123 0.29
124 0.32
125 0.35
126 0.35
127 0.34
128 0.31
129 0.25
130 0.22
131 0.15
132 0.11
133 0.09
134 0.08
135 0.08
136 0.08
137 0.1
138 0.11
139 0.1
140 0.11
141 0.11
142 0.14
143 0.15
144 0.2
145 0.21
146 0.22
147 0.25
148 0.26
149 0.27
150 0.27
151 0.3
152 0.25
153 0.24
154 0.22
155 0.2
156 0.28
157 0.25
158 0.22
159 0.2
160 0.2
161 0.22
162 0.23
163 0.22
164 0.15
165 0.14
166 0.14
167 0.13
168 0.12
169 0.08
170 0.08
171 0.08
172 0.07
173 0.1
174 0.11
175 0.12
176 0.16
177 0.21
178 0.26
179 0.29
180 0.29
181 0.29
182 0.34
183 0.42
184 0.49
185 0.51
186 0.56
187 0.53
188 0.58
189 0.59
190 0.57
191 0.58
192 0.58
193 0.62
194 0.64
195 0.69
196 0.72
197 0.79
198 0.84
199 0.81
200 0.82
201 0.81
202 0.8
203 0.85
204 0.81