Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7SBR5

Protein Details
Accession M7SBR5   
Localization Confidence High
Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
9-38KWDYLPPEKVRAKRQPRPDRVWPARPARKHBasic
128-149AVVDSKKKKKGEEKKIKQRFTTBasic
NLS Segment(s)
PositionSequence
18-36VRAKRQPRPDRVWPARPAR
133-145KKKKKGEEKKIKQ
Subcellular Location(s) nucl 14, cyto_nucl 12, cyto 8, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR029058  AB_hydrolase  
IPR013094  AB_hydrolase_3  
Gene Ontology GO:0016787  F:hydrolase activity  
KEGG ela:UCREL1_9437  -  
Pfam View protein in Pfam  
PF07859  Abhydrolase_3  
Amino Acid Sequences MPSWDANAKWDYLPPEKVRAKRQPRPDRVWPARPARKHLYADDAYLLHPLVSLQMARSWEGAPPVYICCGWECLADEGRFVAAKMAREGVPVVFEEYEAMPHVSAMVFPDLEESRRNVWGWSDFMRAAVVDSKKKKKGEEKKIKQRFTTVRARTLEEFPIDLARLSPFSEDDVRQMARDKVGHEPPVPEARVKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.43
3 0.49
4 0.55
5 0.61
6 0.66
7 0.71
8 0.72
9 0.81
10 0.82
11 0.84
12 0.86
13 0.86
14 0.87
15 0.85
16 0.85
17 0.83
18 0.82
19 0.81
20 0.77
21 0.75
22 0.71
23 0.7
24 0.65
25 0.59
26 0.57
27 0.49
28 0.46
29 0.4
30 0.33
31 0.25
32 0.22
33 0.2
34 0.11
35 0.1
36 0.08
37 0.06
38 0.06
39 0.06
40 0.06
41 0.08
42 0.1
43 0.11
44 0.12
45 0.12
46 0.12
47 0.13
48 0.13
49 0.11
50 0.11
51 0.11
52 0.11
53 0.1
54 0.1
55 0.09
56 0.11
57 0.1
58 0.1
59 0.11
60 0.12
61 0.16
62 0.16
63 0.15
64 0.13
65 0.13
66 0.12
67 0.1
68 0.11
69 0.09
70 0.1
71 0.1
72 0.12
73 0.11
74 0.12
75 0.12
76 0.09
77 0.09
78 0.08
79 0.08
80 0.06
81 0.06
82 0.07
83 0.06
84 0.06
85 0.06
86 0.06
87 0.05
88 0.05
89 0.05
90 0.04
91 0.04
92 0.05
93 0.05
94 0.04
95 0.04
96 0.07
97 0.07
98 0.09
99 0.1
100 0.11
101 0.12
102 0.14
103 0.15
104 0.13
105 0.14
106 0.15
107 0.17
108 0.17
109 0.18
110 0.16
111 0.16
112 0.16
113 0.14
114 0.13
115 0.16
116 0.17
117 0.21
118 0.29
119 0.37
120 0.43
121 0.46
122 0.52
123 0.57
124 0.65
125 0.69
126 0.73
127 0.77
128 0.81
129 0.89
130 0.88
131 0.79
132 0.78
133 0.74
134 0.69
135 0.69
136 0.62
137 0.6
138 0.57
139 0.59
140 0.53
141 0.49
142 0.45
143 0.35
144 0.31
145 0.24
146 0.23
147 0.19
148 0.16
149 0.14
150 0.12
151 0.11
152 0.11
153 0.12
154 0.1
155 0.14
156 0.18
157 0.18
158 0.19
159 0.23
160 0.23
161 0.23
162 0.26
163 0.25
164 0.26
165 0.27
166 0.27
167 0.31
168 0.37
169 0.41
170 0.4
171 0.39
172 0.4
173 0.46
174 0.46