Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7TYN0

Protein Details
Accession M7TYN0   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
326-350EEFERREVDKKKRKEAKFKEKLLDLBasic
NLS Segment(s)
PositionSequence
333-370VDKKKRKEAKFKEKLLDLKKRTRTDAYRRQHGKLRGRG
Subcellular Location(s) nucl 10, cyto 9, mito_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR009061  DNA-bd_dom_put_sf  
IPR000465  XPA  
IPR022656  XPA_C  
IPR037129  XPA_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003684  F:damaged DNA binding  
GO:0046872  F:metal ion binding  
GO:0006289  P:nucleotide-excision repair  
KEGG ela:UCREL1_1155  -  
Pfam View protein in Pfam  
PF05181  XPA_C  
CDD cd21077  DBD_Rad14  
Amino Acid Sequences MEPPSTPRRVTRSSSSKPAASPPTPEVTRRIEENRLRAKALRDQHEAAARTAGTSPVSRTPSGFVATPEIEVPNSRKRTHDAITRSSNTTRIADTPATLRDGRANGASSSSAQDGTTTTAGEKEGAIRPARKFTKFVDYDFGKMTDTKGGFLSAEDDPWNKAMSGAPVKGNGSQQPDGAPAAEEKPKDMTMQEWERLQLLKKLRRQKAGPFEPGLSALKDEKERKKCRECGSFEIDFVWEEVFACAVCAACKEKVPEKYSLLTKTECREDYLLTEPELRDEELLPHLSRPNPHKSHWHDMMLFLRYQVEEYAFGAKKWGSAEALDEEFERREVDKKKRKEAKFKEKLLDLKKRTRTDAYRRQHGKLRGRGGSSNSGGGGGSGGGTAKFGDAVGNNARHVHEWGRAIENEDGATVKTCTTCGMEVEELSF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.7
3 0.66
4 0.62
5 0.64
6 0.62
7 0.54
8 0.52
9 0.46
10 0.49
11 0.48
12 0.48
13 0.45
14 0.43
15 0.44
16 0.45
17 0.46
18 0.47
19 0.52
20 0.59
21 0.63
22 0.6
23 0.6
24 0.58
25 0.57
26 0.56
27 0.58
28 0.56
29 0.53
30 0.52
31 0.54
32 0.57
33 0.54
34 0.46
35 0.41
36 0.33
37 0.27
38 0.25
39 0.22
40 0.16
41 0.16
42 0.18
43 0.22
44 0.26
45 0.25
46 0.26
47 0.27
48 0.28
49 0.28
50 0.26
51 0.21
52 0.22
53 0.22
54 0.22
55 0.2
56 0.18
57 0.17
58 0.18
59 0.22
60 0.26
61 0.31
62 0.31
63 0.33
64 0.37
65 0.43
66 0.47
67 0.51
68 0.48
69 0.51
70 0.58
71 0.59
72 0.58
73 0.53
74 0.5
75 0.44
76 0.39
77 0.33
78 0.26
79 0.27
80 0.23
81 0.23
82 0.23
83 0.22
84 0.24
85 0.22
86 0.21
87 0.21
88 0.21
89 0.21
90 0.21
91 0.21
92 0.17
93 0.18
94 0.18
95 0.15
96 0.15
97 0.15
98 0.13
99 0.11
100 0.11
101 0.11
102 0.13
103 0.12
104 0.1
105 0.09
106 0.1
107 0.1
108 0.1
109 0.1
110 0.11
111 0.14
112 0.17
113 0.2
114 0.24
115 0.26
116 0.34
117 0.39
118 0.38
119 0.37
120 0.37
121 0.44
122 0.42
123 0.42
124 0.41
125 0.37
126 0.37
127 0.36
128 0.33
129 0.23
130 0.22
131 0.21
132 0.18
133 0.17
134 0.16
135 0.15
136 0.14
137 0.14
138 0.13
139 0.16
140 0.1
141 0.11
142 0.11
143 0.11
144 0.11
145 0.12
146 0.12
147 0.09
148 0.09
149 0.09
150 0.13
151 0.17
152 0.18
153 0.18
154 0.19
155 0.2
156 0.21
157 0.22
158 0.21
159 0.22
160 0.21
161 0.21
162 0.2
163 0.2
164 0.18
165 0.16
166 0.13
167 0.09
168 0.1
169 0.13
170 0.12
171 0.12
172 0.14
173 0.14
174 0.14
175 0.14
176 0.13
177 0.17
178 0.2
179 0.21
180 0.2
181 0.2
182 0.2
183 0.21
184 0.21
185 0.19
186 0.23
187 0.28
188 0.35
189 0.44
190 0.49
191 0.54
192 0.56
193 0.59
194 0.62
195 0.62
196 0.59
197 0.51
198 0.46
199 0.4
200 0.39
201 0.32
202 0.21
203 0.15
204 0.12
205 0.12
206 0.16
207 0.22
208 0.29
209 0.38
210 0.45
211 0.52
212 0.6
213 0.66
214 0.69
215 0.72
216 0.68
217 0.65
218 0.64
219 0.56
220 0.48
221 0.41
222 0.33
223 0.24
224 0.19
225 0.13
226 0.06
227 0.06
228 0.05
229 0.05
230 0.04
231 0.04
232 0.04
233 0.04
234 0.04
235 0.05
236 0.07
237 0.08
238 0.1
239 0.13
240 0.19
241 0.26
242 0.29
243 0.32
244 0.32
245 0.36
246 0.39
247 0.39
248 0.36
249 0.32
250 0.32
251 0.31
252 0.34
253 0.3
254 0.28
255 0.25
256 0.23
257 0.24
258 0.26
259 0.24
260 0.19
261 0.21
262 0.19
263 0.19
264 0.2
265 0.17
266 0.12
267 0.12
268 0.12
269 0.12
270 0.15
271 0.14
272 0.14
273 0.17
274 0.18
275 0.22
276 0.26
277 0.34
278 0.35
279 0.38
280 0.46
281 0.51
282 0.58
283 0.58
284 0.58
285 0.48
286 0.47
287 0.49
288 0.42
289 0.34
290 0.25
291 0.21
292 0.16
293 0.16
294 0.14
295 0.11
296 0.09
297 0.1
298 0.18
299 0.17
300 0.16
301 0.18
302 0.17
303 0.18
304 0.18
305 0.18
306 0.12
307 0.12
308 0.14
309 0.16
310 0.16
311 0.15
312 0.15
313 0.14
314 0.14
315 0.14
316 0.13
317 0.11
318 0.17
319 0.25
320 0.36
321 0.45
322 0.53
323 0.63
324 0.72
325 0.8
326 0.84
327 0.87
328 0.88
329 0.88
330 0.88
331 0.84
332 0.8
333 0.8
334 0.78
335 0.78
336 0.74
337 0.73
338 0.75
339 0.72
340 0.71
341 0.71
342 0.71
343 0.71
344 0.74
345 0.74
346 0.75
347 0.76
348 0.76
349 0.75
350 0.75
351 0.75
352 0.73
353 0.73
354 0.68
355 0.66
356 0.66
357 0.63
358 0.61
359 0.52
360 0.45
361 0.36
362 0.3
363 0.26
364 0.21
365 0.16
366 0.08
367 0.06
368 0.05
369 0.05
370 0.05
371 0.05
372 0.06
373 0.05
374 0.06
375 0.05
376 0.08
377 0.08
378 0.13
379 0.19
380 0.21
381 0.22
382 0.24
383 0.25
384 0.24
385 0.28
386 0.26
387 0.25
388 0.27
389 0.3
390 0.33
391 0.33
392 0.35
393 0.34
394 0.31
395 0.26
396 0.22
397 0.2
398 0.15
399 0.16
400 0.13
401 0.12
402 0.12
403 0.12
404 0.13
405 0.16
406 0.16
407 0.16
408 0.2
409 0.21