Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M7SBJ4

Protein Details
Accession M7SBJ4    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
129-152YAMSTPSKRHKTPRKKATPAAKAAHydrophilic
NLS Segment(s)
PositionSequence
90-113AKGRGRGGKGKGATGTPGSRKRKN
136-149KRHKTPRKKATPAA
Subcellular Location(s) cyto_nucl 11.5, nucl 11, cyto 10, mito 6
Family & Domain DBs
KEGG ela:UCREL1_11537  -  
Amino Acid Sequences MSTDKIEKNGKTGGSILTERETEVLAKSWLCMKTPPEVDNEKLARLANFGNPRSVANLMSGIKKKIAAHTAAADGEDGQQDGSAPATPTAKGRGRGGKGKGATGTPGSRKRKNAPAALDDEEVDSDGDYAMSTPSKRHKTPRKKATPAAKAAAAAPAADEGVHGDDVDSELKAEVVEEDAAVKEEVKQEGADKDEAMMIATQMEDGAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.27
3 0.25
4 0.23
5 0.23
6 0.21
7 0.2
8 0.18
9 0.14
10 0.14
11 0.14
12 0.13
13 0.12
14 0.13
15 0.18
16 0.19
17 0.19
18 0.21
19 0.22
20 0.28
21 0.33
22 0.33
23 0.33
24 0.37
25 0.37
26 0.42
27 0.41
28 0.34
29 0.32
30 0.31
31 0.25
32 0.22
33 0.22
34 0.2
35 0.26
36 0.26
37 0.27
38 0.26
39 0.27
40 0.27
41 0.27
42 0.2
43 0.14
44 0.17
45 0.16
46 0.21
47 0.23
48 0.21
49 0.21
50 0.23
51 0.23
52 0.24
53 0.26
54 0.22
55 0.22
56 0.22
57 0.23
58 0.2
59 0.19
60 0.15
61 0.11
62 0.1
63 0.09
64 0.07
65 0.05
66 0.05
67 0.05
68 0.05
69 0.05
70 0.05
71 0.05
72 0.06
73 0.07
74 0.08
75 0.09
76 0.15
77 0.17
78 0.18
79 0.22
80 0.27
81 0.3
82 0.36
83 0.38
84 0.38
85 0.35
86 0.34
87 0.31
88 0.25
89 0.23
90 0.18
91 0.19
92 0.19
93 0.27
94 0.32
95 0.36
96 0.41
97 0.45
98 0.51
99 0.55
100 0.54
101 0.49
102 0.47
103 0.47
104 0.45
105 0.4
106 0.32
107 0.26
108 0.2
109 0.16
110 0.12
111 0.08
112 0.05
113 0.04
114 0.04
115 0.03
116 0.04
117 0.04
118 0.05
119 0.06
120 0.09
121 0.18
122 0.24
123 0.28
124 0.38
125 0.49
126 0.59
127 0.69
128 0.78
129 0.8
130 0.81
131 0.86
132 0.86
133 0.84
134 0.78
135 0.7
136 0.6
137 0.5
138 0.43
139 0.37
140 0.26
141 0.17
142 0.11
143 0.08
144 0.07
145 0.06
146 0.06
147 0.05
148 0.06
149 0.06
150 0.06
151 0.06
152 0.06
153 0.08
154 0.08
155 0.07
156 0.06
157 0.06
158 0.06
159 0.06
160 0.06
161 0.05
162 0.06
163 0.06
164 0.06
165 0.07
166 0.07
167 0.09
168 0.09
169 0.09
170 0.1
171 0.13
172 0.14
173 0.15
174 0.15
175 0.17
176 0.2
177 0.23
178 0.22
179 0.19
180 0.18
181 0.18
182 0.18
183 0.15
184 0.13
185 0.09
186 0.08
187 0.08
188 0.07