Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7TJ10

Protein Details
Accession M7TJ10   
Localization Confidence Low
Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
346-372AVSRHNRRAKDKGLKVHRRRRDESMSMBasic
NLS Segment(s)
PositionSequence
350-366HNRRAKDKGLKVHRRRR
Subcellular Location(s) mito 18, cyto 5, nucl 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR046486  DUF6579  
KEGG ela:UCREL1_3025  -  
Pfam View protein in Pfam  
PF20219  DUF6579  
Amino Acid Sequences MSNLLTQVFKSSEAGKYGKTAARLAGTYAEPIAKTIEAYQNLQGLVKIGAVASRAANLLDKADQLIPSLQVVTDSACDKAALIAQFAMLGSAVGFGVHALQQYQGTQALKLIAARLQEIGETLEAQTVLMAQQLFPQYVYDMVQERLGATSSKREAHWFFVYHPDTDWYPGFTKLVGERRLGPRFCGWSNQLDSLFLFMLAVRKEMADRAANNEKGSRHHRPVKFHILIPAYQPVIVTDFLSCPEAVGDFVIEGKIHNSYPLVWLNLPAEQSHFLHDVGNWTPPSPGWVDWLLKSMALRNKPSEARRELGTIPMPAITEKSIDGEDAEKPATVEDEVVEQAVIEEAVSRHNRRAKDKGLKVHRRRRDESMSMEKQLPPAESQGGGGLRQLLSRSDSSMSPDGLSRGRSRMRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.25
3 0.28
4 0.33
5 0.34
6 0.33
7 0.31
8 0.29
9 0.31
10 0.3
11 0.28
12 0.26
13 0.24
14 0.22
15 0.21
16 0.2
17 0.16
18 0.16
19 0.17
20 0.13
21 0.13
22 0.16
23 0.22
24 0.23
25 0.26
26 0.27
27 0.28
28 0.28
29 0.28
30 0.23
31 0.18
32 0.16
33 0.13
34 0.11
35 0.08
36 0.08
37 0.09
38 0.1
39 0.09
40 0.09
41 0.09
42 0.1
43 0.11
44 0.11
45 0.12
46 0.12
47 0.12
48 0.14
49 0.15
50 0.15
51 0.15
52 0.16
53 0.14
54 0.14
55 0.14
56 0.11
57 0.1
58 0.1
59 0.09
60 0.1
61 0.1
62 0.1
63 0.1
64 0.1
65 0.1
66 0.1
67 0.13
68 0.11
69 0.11
70 0.11
71 0.1
72 0.1
73 0.1
74 0.09
75 0.05
76 0.05
77 0.04
78 0.04
79 0.04
80 0.03
81 0.03
82 0.03
83 0.04
84 0.05
85 0.05
86 0.05
87 0.06
88 0.07
89 0.08
90 0.09
91 0.12
92 0.12
93 0.12
94 0.13
95 0.13
96 0.13
97 0.13
98 0.13
99 0.11
100 0.11
101 0.11
102 0.11
103 0.1
104 0.1
105 0.1
106 0.09
107 0.08
108 0.08
109 0.07
110 0.07
111 0.07
112 0.07
113 0.06
114 0.05
115 0.05
116 0.06
117 0.06
118 0.05
119 0.09
120 0.1
121 0.11
122 0.11
123 0.11
124 0.09
125 0.1
126 0.11
127 0.09
128 0.1
129 0.11
130 0.11
131 0.11
132 0.11
133 0.1
134 0.1
135 0.09
136 0.08
137 0.13
138 0.15
139 0.17
140 0.18
141 0.22
142 0.23
143 0.28
144 0.31
145 0.26
146 0.25
147 0.32
148 0.33
149 0.28
150 0.27
151 0.24
152 0.21
153 0.22
154 0.21
155 0.14
156 0.14
157 0.14
158 0.14
159 0.12
160 0.13
161 0.15
162 0.22
163 0.22
164 0.22
165 0.26
166 0.33
167 0.4
168 0.38
169 0.36
170 0.32
171 0.33
172 0.33
173 0.32
174 0.27
175 0.25
176 0.27
177 0.27
178 0.24
179 0.21
180 0.2
181 0.17
182 0.15
183 0.1
184 0.07
185 0.05
186 0.08
187 0.08
188 0.08
189 0.07
190 0.07
191 0.07
192 0.08
193 0.1
194 0.09
195 0.1
196 0.15
197 0.22
198 0.22
199 0.23
200 0.25
201 0.24
202 0.26
203 0.33
204 0.34
205 0.35
206 0.43
207 0.47
208 0.51
209 0.57
210 0.63
211 0.58
212 0.53
213 0.51
214 0.43
215 0.4
216 0.35
217 0.3
218 0.2
219 0.18
220 0.17
221 0.11
222 0.11
223 0.11
224 0.09
225 0.07
226 0.07
227 0.08
228 0.09
229 0.08
230 0.07
231 0.06
232 0.06
233 0.06
234 0.05
235 0.05
236 0.04
237 0.04
238 0.04
239 0.04
240 0.04
241 0.05
242 0.06
243 0.06
244 0.07
245 0.07
246 0.07
247 0.11
248 0.13
249 0.14
250 0.13
251 0.14
252 0.15
253 0.16
254 0.16
255 0.12
256 0.12
257 0.13
258 0.13
259 0.15
260 0.15
261 0.14
262 0.14
263 0.14
264 0.16
265 0.14
266 0.18
267 0.15
268 0.14
269 0.14
270 0.14
271 0.16
272 0.14
273 0.13
274 0.13
275 0.16
276 0.17
277 0.17
278 0.2
279 0.18
280 0.17
281 0.17
282 0.2
283 0.22
284 0.26
285 0.29
286 0.29
287 0.35
288 0.41
289 0.45
290 0.47
291 0.46
292 0.43
293 0.41
294 0.42
295 0.37
296 0.36
297 0.34
298 0.26
299 0.22
300 0.2
301 0.19
302 0.15
303 0.16
304 0.12
305 0.1
306 0.1
307 0.11
308 0.1
309 0.1
310 0.11
311 0.11
312 0.12
313 0.13
314 0.13
315 0.11
316 0.11
317 0.11
318 0.11
319 0.1
320 0.09
321 0.07
322 0.09
323 0.09
324 0.09
325 0.08
326 0.07
327 0.07
328 0.07
329 0.06
330 0.04
331 0.05
332 0.05
333 0.12
334 0.18
335 0.2
336 0.27
337 0.33
338 0.39
339 0.45
340 0.54
341 0.58
342 0.63
343 0.69
344 0.73
345 0.78
346 0.84
347 0.87
348 0.89
349 0.88
350 0.87
351 0.84
352 0.83
353 0.81
354 0.76
355 0.75
356 0.75
357 0.71
358 0.65
359 0.64
360 0.56
361 0.5
362 0.46
363 0.39
364 0.3
365 0.28
366 0.26
367 0.23
368 0.22
369 0.23
370 0.21
371 0.19
372 0.18
373 0.18
374 0.16
375 0.17
376 0.17
377 0.15
378 0.18
379 0.19
380 0.21
381 0.2
382 0.21
383 0.26
384 0.28
385 0.27
386 0.25
387 0.25
388 0.26
389 0.27
390 0.3
391 0.27
392 0.31