Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4RZG8

Protein Details
Accession F4RZG8    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
41-71PASTTRFQRYHRSKRRRKQYHLRNRNPRSERBasic
NLS Segment(s)
PositionSequence
51-71HRSKRRRKQYHLRNRNPRSER
Subcellular Location(s) nucl 20.5, cyto_nucl 11.5, mito 4
Family & Domain DBs
KEGG mlr:MELLADRAFT_91553  -  
Amino Acid Sequences MAKTPSRSQGSQRPTRQNNASVCSVSKGTRTTFGYGGKTTPASTTRFQRYHRSKRRRKQYHLRNRNPRSER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.74
3 0.72
4 0.7
5 0.65
6 0.59
7 0.53
8 0.43
9 0.38
10 0.32
11 0.29
12 0.22
13 0.21
14 0.18
15 0.17
16 0.2
17 0.22
18 0.22
19 0.23
20 0.24
21 0.24
22 0.22
23 0.22
24 0.18
25 0.16
26 0.14
27 0.14
28 0.14
29 0.15
30 0.18
31 0.24
32 0.31
33 0.36
34 0.39
35 0.48
36 0.56
37 0.64
38 0.72
39 0.76
40 0.79
41 0.85
42 0.93
43 0.93
44 0.93
45 0.93
46 0.93
47 0.94
48 0.94
49 0.95
50 0.95
51 0.92