Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F4RP98

Protein Details
Accession F4RP98    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
382-407SEPKVESPKPKGKTKVKARVRFGGTDHydrophilic
NLS Segment(s)
PositionSequence
389-400PKPKGKTKVKAR
Subcellular Location(s) mito_nucl 11.332, nucl 11, mito 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR008728  Elongator_complex_protein_4  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0033588  C:elongator holoenzyme complex  
GO:0005634  C:nucleus  
GO:0002098  P:tRNA wobble uridine modification  
KEGG mlr:MELLADRAFT_116710  -  
Pfam View protein in Pfam  
PF05625  PAXNEB  
CDD cd19494  Elp4  
Amino Acid Sequences MSSFKKKIPSGSTIPTGFYPSHYNGLPLTSTGIASLDDVLGGGIPASSSFLVAEDSDSSYSRLVLRYWITQGLAAGQRSLVIGSSLDDGGGPTALIDRLMDLTDNEKSAQVPVHDTGLDDDDEEEESNLDDKSKQMKIAWRYESLGKHQAQTELHQRGQCHSFDLSKTMVLSDEQRKRISCIDVADCPSYDDLLNQIDQIISAPHPPSHPYPPLRIAIHSLGSPGSPAASHTILFKFLVRLKSLLQPSSSVAMITFPSTIYSAQAMPMLCWATDGCLALESFAGNDASQTAFPNHQGVCHFLRLPSHASLSPPSTKLSVLRGLGASDSAEAGGIDTNLGFKVGRRKGFRIEMMGLGIDAEPIEDPASHPYSESIVNPEPVISEPKVESPKPKGKTKVKARVRFGGTDDLEDHASHKHPVKHLGNTDW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.44
3 0.41
4 0.34
5 0.3
6 0.29
7 0.25
8 0.28
9 0.26
10 0.27
11 0.24
12 0.26
13 0.24
14 0.18
15 0.18
16 0.14
17 0.14
18 0.13
19 0.13
20 0.11
21 0.1
22 0.11
23 0.08
24 0.07
25 0.06
26 0.06
27 0.05
28 0.05
29 0.04
30 0.03
31 0.03
32 0.03
33 0.05
34 0.05
35 0.06
36 0.06
37 0.06
38 0.08
39 0.08
40 0.1
41 0.09
42 0.11
43 0.12
44 0.13
45 0.14
46 0.13
47 0.14
48 0.15
49 0.15
50 0.13
51 0.17
52 0.19
53 0.22
54 0.24
55 0.25
56 0.24
57 0.23
58 0.23
59 0.22
60 0.24
61 0.2
62 0.18
63 0.15
64 0.15
65 0.15
66 0.15
67 0.1
68 0.06
69 0.06
70 0.07
71 0.09
72 0.08
73 0.08
74 0.08
75 0.08
76 0.07
77 0.07
78 0.06
79 0.04
80 0.05
81 0.05
82 0.06
83 0.05
84 0.06
85 0.06
86 0.07
87 0.07
88 0.07
89 0.1
90 0.11
91 0.12
92 0.12
93 0.12
94 0.12
95 0.13
96 0.15
97 0.13
98 0.15
99 0.15
100 0.16
101 0.15
102 0.15
103 0.15
104 0.15
105 0.14
106 0.1
107 0.1
108 0.09
109 0.09
110 0.09
111 0.08
112 0.06
113 0.07
114 0.07
115 0.07
116 0.07
117 0.07
118 0.09
119 0.15
120 0.16
121 0.18
122 0.21
123 0.28
124 0.34
125 0.42
126 0.43
127 0.4
128 0.41
129 0.44
130 0.44
131 0.42
132 0.43
133 0.36
134 0.34
135 0.33
136 0.35
137 0.31
138 0.32
139 0.36
140 0.32
141 0.34
142 0.34
143 0.33
144 0.33
145 0.35
146 0.31
147 0.25
148 0.21
149 0.21
150 0.19
151 0.21
152 0.18
153 0.15
154 0.15
155 0.13
156 0.12
157 0.1
158 0.14
159 0.21
160 0.27
161 0.3
162 0.32
163 0.32
164 0.34
165 0.37
166 0.34
167 0.27
168 0.24
169 0.24
170 0.25
171 0.27
172 0.25
173 0.22
174 0.2
175 0.17
176 0.14
177 0.12
178 0.09
179 0.07
180 0.08
181 0.08
182 0.07
183 0.07
184 0.06
185 0.06
186 0.06
187 0.05
188 0.05
189 0.07
190 0.07
191 0.08
192 0.09
193 0.11
194 0.14
195 0.19
196 0.24
197 0.25
198 0.27
199 0.3
200 0.33
201 0.31
202 0.29
203 0.27
204 0.22
205 0.21
206 0.18
207 0.15
208 0.11
209 0.1
210 0.09
211 0.06
212 0.05
213 0.04
214 0.04
215 0.07
216 0.07
217 0.07
218 0.09
219 0.1
220 0.11
221 0.11
222 0.11
223 0.11
224 0.15
225 0.17
226 0.16
227 0.17
228 0.18
229 0.24
230 0.26
231 0.25
232 0.21
233 0.2
234 0.2
235 0.21
236 0.19
237 0.12
238 0.1
239 0.09
240 0.09
241 0.08
242 0.07
243 0.06
244 0.06
245 0.07
246 0.07
247 0.07
248 0.08
249 0.07
250 0.08
251 0.1
252 0.1
253 0.09
254 0.11
255 0.1
256 0.09
257 0.09
258 0.09
259 0.08
260 0.09
261 0.1
262 0.08
263 0.08
264 0.08
265 0.08
266 0.08
267 0.06
268 0.05
269 0.06
270 0.06
271 0.05
272 0.05
273 0.05
274 0.06
275 0.07
276 0.08
277 0.09
278 0.1
279 0.11
280 0.14
281 0.14
282 0.15
283 0.16
284 0.19
285 0.2
286 0.22
287 0.22
288 0.19
289 0.21
290 0.22
291 0.25
292 0.22
293 0.22
294 0.2
295 0.21
296 0.23
297 0.25
298 0.26
299 0.24
300 0.24
301 0.22
302 0.22
303 0.22
304 0.23
305 0.24
306 0.21
307 0.22
308 0.21
309 0.2
310 0.19
311 0.18
312 0.14
313 0.09
314 0.08
315 0.06
316 0.06
317 0.05
318 0.05
319 0.05
320 0.05
321 0.05
322 0.04
323 0.05
324 0.05
325 0.06
326 0.05
327 0.08
328 0.18
329 0.25
330 0.32
331 0.37
332 0.42
333 0.49
334 0.56
335 0.57
336 0.53
337 0.49
338 0.43
339 0.38
340 0.34
341 0.26
342 0.2
343 0.16
344 0.1
345 0.07
346 0.06
347 0.05
348 0.05
349 0.06
350 0.06
351 0.07
352 0.12
353 0.15
354 0.15
355 0.15
356 0.16
357 0.17
358 0.19
359 0.19
360 0.21
361 0.21
362 0.22
363 0.22
364 0.21
365 0.2
366 0.2
367 0.24
368 0.18
369 0.18
370 0.18
371 0.25
372 0.31
373 0.33
374 0.38
375 0.43
376 0.52
377 0.55
378 0.63
379 0.66
380 0.7
381 0.78
382 0.82
383 0.83
384 0.85
385 0.88
386 0.86
387 0.86
388 0.81
389 0.75
390 0.67
391 0.66
392 0.56
393 0.5
394 0.44
395 0.37
396 0.33
397 0.28
398 0.25
399 0.19
400 0.2
401 0.22
402 0.28
403 0.32
404 0.36
405 0.46
406 0.51
407 0.57