Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7T144

Protein Details
Accession M7T144   
Localization Confidence High
Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
40-63EELEKERAEKKQKKDEREAEKAERAcidic
NLS Segment(s)
PositionSequence
33-97KAKRKTAEELEKERAEKKQKKDEREAEKAERARINAEKEAVKKAKAAEKAKLEAEKEALRRKKDE
105-105K
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR022043  CAF1A  
Gene Ontology GO:0005634  C:nucleus  
KEGG ela:UCREL1_9516  -  
Pfam View protein in Pfam  
PF12253  CAF1A  
Amino Acid Sequences MTLTQTSPSAQPNPPAPSAMPPTSNSKTTAATKAKRKTAEELEKERAEKKQKKDEREAEKAERARINAEKEAVKKAKAAEKAKLEAEKEALRRKKDEEEQAVIKKKEKQQNLMASFLKRAPATPVKKSVNPESFEISAESVNPATHKETESEVCAYDRQFKPFFVKPGVKLAPTAFEMDEEAKETKSRILDEFVQKKRDEFNPRPFNPMETFQLNGLPHPRGIMPRCVKEAVEQVYGDSLTNTFGMAPVKTESQEEKLSTVQDKLNAVPMKYLSFFEDVRPPYFGTMTTRMICKTLRKLCVNPTRRTLNTVNYDYDSEAEWVEEEGEDLDDCEDDEEDDVDEELEDFLDDSEDALAANRPAFIGELQPASTGLCFENRKRLGPCTTLYKYKLEVLLGMSCKLTFTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.43
3 0.38
4 0.39
5 0.43
6 0.41
7 0.37
8 0.34
9 0.41
10 0.43
11 0.44
12 0.4
13 0.35
14 0.36
15 0.38
16 0.46
17 0.47
18 0.51
19 0.58
20 0.64
21 0.69
22 0.7
23 0.69
24 0.68
25 0.69
26 0.72
27 0.71
28 0.7
29 0.7
30 0.69
31 0.67
32 0.63
33 0.6
34 0.6
35 0.59
36 0.61
37 0.64
38 0.68
39 0.75
40 0.82
41 0.84
42 0.82
43 0.83
44 0.82
45 0.78
46 0.78
47 0.72
48 0.68
49 0.62
50 0.53
51 0.49
52 0.47
53 0.45
54 0.4
55 0.41
56 0.39
57 0.38
58 0.47
59 0.44
60 0.4
61 0.37
62 0.39
63 0.42
64 0.45
65 0.47
66 0.45
67 0.48
68 0.51
69 0.53
70 0.52
71 0.46
72 0.39
73 0.38
74 0.37
75 0.36
76 0.42
77 0.44
78 0.43
79 0.46
80 0.48
81 0.52
82 0.55
83 0.59
84 0.56
85 0.56
86 0.59
87 0.63
88 0.67
89 0.6
90 0.56
91 0.54
92 0.56
93 0.58
94 0.58
95 0.58
96 0.58
97 0.67
98 0.65
99 0.63
100 0.58
101 0.51
102 0.47
103 0.41
104 0.35
105 0.24
106 0.22
107 0.23
108 0.3
109 0.34
110 0.37
111 0.44
112 0.46
113 0.5
114 0.54
115 0.56
116 0.53
117 0.5
118 0.47
119 0.42
120 0.38
121 0.35
122 0.31
123 0.23
124 0.16
125 0.14
126 0.13
127 0.09
128 0.08
129 0.08
130 0.09
131 0.11
132 0.12
133 0.13
134 0.13
135 0.15
136 0.17
137 0.18
138 0.18
139 0.16
140 0.15
141 0.16
142 0.15
143 0.22
144 0.22
145 0.25
146 0.25
147 0.25
148 0.3
149 0.33
150 0.36
151 0.33
152 0.35
153 0.32
154 0.39
155 0.4
156 0.34
157 0.32
158 0.29
159 0.25
160 0.21
161 0.22
162 0.13
163 0.11
164 0.12
165 0.12
166 0.11
167 0.11
168 0.11
169 0.09
170 0.1
171 0.1
172 0.11
173 0.12
174 0.13
175 0.12
176 0.14
177 0.19
178 0.27
179 0.35
180 0.37
181 0.4
182 0.38
183 0.39
184 0.4
185 0.42
186 0.43
187 0.41
188 0.49
189 0.55
190 0.56
191 0.6
192 0.56
193 0.51
194 0.44
195 0.4
196 0.32
197 0.23
198 0.22
199 0.17
200 0.21
201 0.18
202 0.17
203 0.16
204 0.14
205 0.13
206 0.13
207 0.14
208 0.15
209 0.17
210 0.25
211 0.27
212 0.29
213 0.31
214 0.31
215 0.3
216 0.28
217 0.32
218 0.26
219 0.24
220 0.21
221 0.18
222 0.18
223 0.18
224 0.16
225 0.1
226 0.07
227 0.06
228 0.06
229 0.06
230 0.05
231 0.06
232 0.07
233 0.07
234 0.08
235 0.08
236 0.09
237 0.1
238 0.12
239 0.13
240 0.15
241 0.18
242 0.17
243 0.18
244 0.18
245 0.2
246 0.19
247 0.2
248 0.18
249 0.18
250 0.19
251 0.18
252 0.24
253 0.24
254 0.23
255 0.22
256 0.21
257 0.2
258 0.2
259 0.2
260 0.14
261 0.15
262 0.16
263 0.16
264 0.23
265 0.23
266 0.23
267 0.24
268 0.22
269 0.21
270 0.21
271 0.2
272 0.18
273 0.21
274 0.23
275 0.23
276 0.24
277 0.23
278 0.25
279 0.27
280 0.27
281 0.33
282 0.37
283 0.43
284 0.46
285 0.5
286 0.58
287 0.66
288 0.68
289 0.63
290 0.62
291 0.62
292 0.58
293 0.61
294 0.55
295 0.52
296 0.52
297 0.5
298 0.46
299 0.4
300 0.41
301 0.34
302 0.31
303 0.24
304 0.17
305 0.14
306 0.11
307 0.09
308 0.08
309 0.08
310 0.07
311 0.06
312 0.06
313 0.06
314 0.06
315 0.06
316 0.06
317 0.06
318 0.06
319 0.06
320 0.06
321 0.06
322 0.06
323 0.07
324 0.07
325 0.07
326 0.07
327 0.07
328 0.07
329 0.07
330 0.06
331 0.06
332 0.05
333 0.05
334 0.05
335 0.05
336 0.05
337 0.05
338 0.06
339 0.05
340 0.05
341 0.06
342 0.08
343 0.08
344 0.09
345 0.08
346 0.08
347 0.09
348 0.1
349 0.1
350 0.11
351 0.13
352 0.14
353 0.14
354 0.15
355 0.15
356 0.14
357 0.14
358 0.12
359 0.11
360 0.16
361 0.21
362 0.23
363 0.34
364 0.36
365 0.43
366 0.45
367 0.5
368 0.5
369 0.5
370 0.51
371 0.51
372 0.53
373 0.55
374 0.55
375 0.52
376 0.49
377 0.49
378 0.47
379 0.39
380 0.35
381 0.3
382 0.34
383 0.31
384 0.3
385 0.25
386 0.22