Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M7S5H4

Protein Details
Accession M7S5H4    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
31-58PPSSPPPKADIRPKKRRRLTTKVIPQDIHydrophilic
NLS Segment(s)
PositionSequence
37-48PKADIRPKKRRR
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR028005  AcTrfase_ESCO_Znf_dom  
KEGG ela:UCREL1_11763  -  
Pfam View protein in Pfam  
PF13878  zf-C2H2_3  
Amino Acid Sequences MNYFKVVSPSSNNLSSSTEPSSCGAEPISTPPSSPPPKADIRPKKRRRLTTKVIPQDIETDEPAENKDPDNPFSEGDRPVPIPSDKEAAAGILTGTSTSTLNKATAPSQQRSEAGKRGKSHKGPSVKSATVQTTLSLSMSDQGFTECKECNMLYNPYHAKDAKIHAKRHAAILKTKSKSKASDETA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.34
3 0.33
4 0.32
5 0.27
6 0.25
7 0.26
8 0.27
9 0.23
10 0.21
11 0.18
12 0.14
13 0.15
14 0.18
15 0.21
16 0.17
17 0.18
18 0.19
19 0.28
20 0.32
21 0.33
22 0.31
23 0.33
24 0.4
25 0.46
26 0.55
27 0.57
28 0.63
29 0.72
30 0.79
31 0.84
32 0.86
33 0.9
34 0.88
35 0.87
36 0.86
37 0.86
38 0.87
39 0.85
40 0.79
41 0.69
42 0.6
43 0.54
44 0.46
45 0.37
46 0.27
47 0.2
48 0.16
49 0.16
50 0.16
51 0.15
52 0.14
53 0.12
54 0.17
55 0.17
56 0.18
57 0.22
58 0.21
59 0.2
60 0.22
61 0.24
62 0.2
63 0.19
64 0.19
65 0.16
66 0.15
67 0.17
68 0.15
69 0.14
70 0.14
71 0.15
72 0.13
73 0.13
74 0.13
75 0.1
76 0.1
77 0.08
78 0.06
79 0.04
80 0.03
81 0.03
82 0.03
83 0.03
84 0.04
85 0.04
86 0.05
87 0.06
88 0.07
89 0.07
90 0.08
91 0.09
92 0.16
93 0.2
94 0.22
95 0.23
96 0.25
97 0.27
98 0.3
99 0.33
100 0.34
101 0.35
102 0.38
103 0.4
104 0.45
105 0.5
106 0.52
107 0.54
108 0.54
109 0.57
110 0.54
111 0.57
112 0.57
113 0.5
114 0.46
115 0.43
116 0.38
117 0.31
118 0.29
119 0.23
120 0.17
121 0.16
122 0.15
123 0.11
124 0.09
125 0.1
126 0.1
127 0.1
128 0.09
129 0.1
130 0.11
131 0.11
132 0.13
133 0.1
134 0.11
135 0.14
136 0.14
137 0.16
138 0.21
139 0.25
140 0.24
141 0.32
142 0.35
143 0.34
144 0.39
145 0.36
146 0.33
147 0.33
148 0.41
149 0.43
150 0.47
151 0.49
152 0.52
153 0.6
154 0.59
155 0.62
156 0.6
157 0.54
158 0.54
159 0.59
160 0.61
161 0.58
162 0.64
163 0.62
164 0.62
165 0.63
166 0.62