Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7SGG3

Protein Details
Accession M7SGG3   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
16-41LWKTPWRLSKFQKARQRRRLRAVDAVHydrophilic
77-103KYTMFDRKEKRYRKGIHKLPKWTRVSQHydrophilic
NLS Segment(s)
PositionSequence
84-95KEKRYRKGIHKL
Subcellular Location(s) mito 20, cyto_mito 12.333, mito_nucl 12.333, nucl 3.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
KEGG ela:UCREL1_7657  -  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFRFTNPLSGGLLWKTPWRLSKFQKARQRRRLRAVDAVIDTLDKALKKQGETLKALDVWKETMPTEAEMLPKDKYTMFDRKEKRYRKGIHKLPKWTRVSQRVNPPGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.16
4 0.19
5 0.2
6 0.22
7 0.29
8 0.33
9 0.4
10 0.46
11 0.56
12 0.62
13 0.68
14 0.75
15 0.79
16 0.84
17 0.86
18 0.9
19 0.88
20 0.88
21 0.87
22 0.81
23 0.78
24 0.7
25 0.63
26 0.53
27 0.45
28 0.35
29 0.26
30 0.21
31 0.13
32 0.12
33 0.07
34 0.06
35 0.1
36 0.11
37 0.12
38 0.18
39 0.22
40 0.25
41 0.27
42 0.28
43 0.26
44 0.26
45 0.26
46 0.2
47 0.17
48 0.14
49 0.12
50 0.12
51 0.1
52 0.1
53 0.11
54 0.11
55 0.12
56 0.11
57 0.12
58 0.12
59 0.14
60 0.13
61 0.13
62 0.13
63 0.12
64 0.14
65 0.19
66 0.27
67 0.29
68 0.38
69 0.44
70 0.54
71 0.63
72 0.68
73 0.7
74 0.71
75 0.77
76 0.78
77 0.82
78 0.82
79 0.83
80 0.83
81 0.87
82 0.86
83 0.87
84 0.82
85 0.8
86 0.8
87 0.79
88 0.8
89 0.77
90 0.79