Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7SCS4

Protein Details
Accession M7SCS4    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MTDKKQTTTPKRDPNPNKHAKPLHEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, mito 7, cyto 7, cyto_mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR036770  Ankyrin_rpt-contain_sf  
KEGG ela:UCREL1_11074  -  
Amino Acid Sequences MTDKKQTTTPKRDPNPNKHAKPLHEIGYMLDPIEQRLAWAREAVEAGRDVNQLDDAADWRRNLGRPLHAALEHPGCFDDATGKTKDRYESLDLVRFLLDHGADPRLRCCRGQDSPIDVARAQAASNANNARVREFNEKALEMMEESAKIKDGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.89
3 0.89
4 0.83
5 0.82
6 0.81
7 0.74
8 0.72
9 0.66
10 0.6
11 0.51
12 0.47
13 0.39
14 0.36
15 0.31
16 0.23
17 0.2
18 0.15
19 0.14
20 0.15
21 0.13
22 0.09
23 0.15
24 0.17
25 0.15
26 0.16
27 0.16
28 0.15
29 0.17
30 0.16
31 0.11
32 0.1
33 0.1
34 0.11
35 0.11
36 0.1
37 0.09
38 0.1
39 0.08
40 0.08
41 0.07
42 0.07
43 0.1
44 0.12
45 0.11
46 0.12
47 0.14
48 0.15
49 0.18
50 0.2
51 0.21
52 0.21
53 0.23
54 0.24
55 0.22
56 0.22
57 0.21
58 0.21
59 0.17
60 0.15
61 0.13
62 0.11
63 0.11
64 0.1
65 0.11
66 0.09
67 0.12
68 0.14
69 0.14
70 0.15
71 0.18
72 0.19
73 0.17
74 0.2
75 0.21
76 0.24
77 0.26
78 0.3
79 0.28
80 0.27
81 0.26
82 0.22
83 0.18
84 0.14
85 0.11
86 0.07
87 0.08
88 0.11
89 0.12
90 0.13
91 0.17
92 0.21
93 0.23
94 0.23
95 0.26
96 0.31
97 0.34
98 0.38
99 0.39
100 0.4
101 0.44
102 0.45
103 0.43
104 0.35
105 0.3
106 0.27
107 0.22
108 0.16
109 0.14
110 0.15
111 0.13
112 0.19
113 0.2
114 0.22
115 0.25
116 0.26
117 0.25
118 0.26
119 0.3
120 0.33
121 0.34
122 0.36
123 0.37
124 0.37
125 0.35
126 0.33
127 0.29
128 0.21
129 0.2
130 0.15
131 0.13
132 0.13
133 0.14